KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507577
Entry
107507577         CDS       T06036                                 

Definition
(RefSeq) Ig heavy chain Mem5-like
  KO
K06856  immunoglobulin heavy chain
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04064  NF-kappa B signaling pathway
ray04072  Phospholipase D signaling pathway
ray04145  Phagosome
ray04151  PI3K-Akt signaling pathway
ray04640  Hematopoietic cell lineage
ray04650  Natural killer cell mediated cytotoxicity
ray04662  B cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04672  Intestinal immune network for IgA production
ray05135  Yersinia infection
ray05140  Leishmaniasis
ray05143  African trypanosomiasis
ray05146  Amoebiasis
ray05150  Staphylococcus aureus infection
ray05152  Tuberculosis
ray05169  Epstein-Barr virus infection
ray05171  Coronavirus disease - COVID-19
ray05202  Transcriptional misregulation in cancer
ray05310  Asthma
ray05320  Autoimmune thyroid disease
ray05322  Systemic lupus erythematosus
ray05323  Rheumatoid arthritis
ray05330  Allograft rejection
ray05340  Primary immunodeficiency
ray05414  Dilated cardiomyopathy
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    107507577
   04020 Calcium signaling pathway
    107507577
   04072 Phospholipase D signaling pathway
    107507577
   04151 PI3K-Akt signaling pathway
    107507577
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107507577
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107507577
   04650 Natural killer cell mediated cytotoxicity
    107507577
   04662 B cell receptor signaling pathway
    107507577
   04664 Fc epsilon RI signaling pathway
    107507577
   04666 Fc gamma R-mediated phagocytosis
    107507577
   04672 Intestinal immune network for IgA production
    107507577
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    107507577
  09163 Immune disease
   05310 Asthma
    107507577
   05322 Systemic lupus erythematosus
    107507577
   05323 Rheumatoid arthritis
    107507577
   05320 Autoimmune thyroid disease
    107507577
   05330 Allograft rejection
    107507577
   05340 Primary immunodeficiency
    107507577
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    107507577
   05416 Viral myocarditis
    107507577
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107507577
   05150 Staphylococcus aureus infection
    107507577
   05152 Tuberculosis
    107507577
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    107507577
   05169 Epstein-Barr virus infection
    107507577
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107507577
   05140 Leishmaniasis
    107507577
   05143 African trypanosomiasis
    107507577
Membrane trafficking [BR:ray04131]
 Endocytosis
  Phagocytosis
   Opsonins
    107507577
SSDB
Motif
Pfam: V-set Ig_3
Other DBs
NCBI-GeneID: 107507577
NCBI-ProteinID: XP_015994181
LinkDB
Position
Unknown
AA seq 244 aa
MDWSWSVLLLVALATGVHAQVQLVQSGAEVRKPGASVKLSCKASGYSFTSYAMHWVRQAP
GQGLEWMGRVIPIVGSTNYAQKFQGRVTITADQSTSTAYMELSSLRTEDTAVYYCAKDTV
RGPQYPGVVIAVDPPHTRKCSQTPACVCPHTPGHDAPLPSSSQAQPPGNCRTTSSSEPNE
IIHTSQAQLLTTFASLPGNPSKAQAQSPFSLRYTSPDTVVSSMWPLLAPNLLSLGPVAVI
NCFA
NT seq 735 nt   +upstreamnt  +downstreamnt
atggactggagctggagcgtcctcctcctggtggcactggcgacaggtgtccacgcccag
gtgcagctggtgcagtctggggccgaggtgaggaagcctggggcctccgtgaagctctcc
tgcaaggcttccggatacagcttcaccagctatgctatgcactgggtgcgacaggcacca
ggtcaagggcttgagtggatgggacgggttatccctatagttggtagcacaaactatgcg
cagaagttccagggcagagtcaccatcaccgccgaccagtccaccagcacagcctacatg
gagctgagcagtctgaggactgaggacacggccgtgtattactgtgcgaaagacacagtg
aggggacctcagtaccccggcgtggtcattgcagtagatcctccccacaccaggaaatgc
tcccagacacccgcctgtgtctgcccgcacaccccgggacacgatgctcctctgccgtcg
tcatcccaggcccagccgccaggcaactgcagaaccacgtccagctctgagcccaacgaa
attattcacacgagtcaggcacagctcctcaccaccttcgcctcattaccaggaaacccc
agtaaagcacaggcccaaagtcccttctcccttcgctacacgtctcctgacaccgtggtg
tcttccatgtggcccctgctggcacccaacctcctgtctctaggacctgtggctgtgatc
aactgttttgcctga

DBGET integrated database retrieval system