KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507608
Entry
107507608         CDS       T06036                                 

Definition
(RefSeq) gamma-sarcoglycan-like isoform X1
  KO
K12564  gamma-sarcoglycan
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107507608
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107507608
   05414 Dilated cardiomyopathy
    107507608
   05416 Viral myocarditis
    107507608
SSDB
Motif
Pfam: Sarcoglycan_1
Other DBs
NCBI-GeneID: 107507608
NCBI-ProteinID: XP_015994208
LinkDB
Position
Unknown
AA seq 156 aa
MVREQYTTTTEGTHVERPEDQCAYKIGIYGWRKRCLYLFVLLLLIILLVNFGLTIWILKV
MWFSPTGMGHLRVTNDGLRLDGESEFLFPLYAKEVHSRVRLLLPSSGNHKLFLHGQLRHR
LPQRSDPQGQNMNSLLGVSLNTVHSCIVALIKLSRS
NT seq 471 nt   +upstreamnt  +downstreamnt
atggtgcgtgaacagtacaccacaaccacggaaggcacccacgtagagaggccagaggac
caatgcgcctacaaaatcggcatttatggctggagaaagcgttgcctctacttatttgtt
cttcttttactcatcattctccttgtgaattttggtcttacaatttggattcttaaagtg
atgtggttttccccaacaggaatgggtcacttgcgtgtcacaaatgacgggcttcgcctg
gacggggaatccgaatttttgttcccattgtacgccaaagaagtacactccagagtgcgc
ctccttctcccttcatcagggaaccataaactgtttcttcatggtcagctcagacatcgt
ctcccccagagatctgatccccaaggacagaacatgaattctttgctaggggtctcatta
aacactgtccattcctgcattgtggcacttatcaaactgtcccggagctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519710
Entry
107519710         CDS       T06036                                 

Gene name
SGCG
Definition
(RefSeq) gamma-sarcoglycan
  KO
K12564  gamma-sarcoglycan
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107519710 (SGCG)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107519710 (SGCG)
   05414 Dilated cardiomyopathy
    107519710 (SGCG)
   05416 Viral myocarditis
    107519710 (SGCG)
SSDB
Motif
Pfam: Sarcoglycan_1 DUF2345
Other DBs
NCBI-GeneID: 107519710
NCBI-ProteinID: XP_016018149
LinkDB
Position
Unknown
AA seq 291 aa
MVREQYTTTTEGTHVERPENQCAYKIGIYGWRKRCLYLFVLLLLIILLVNFGLTIWILKV
MWFSPTGMGHLRVTNDGLRLEGESEFLFPLYAKEVHSRVDSSLLLQSTQNVTVNARNSEG
EVTGRLKVGPQMVEVQSQQFQINSKEGKPLFTVDEKEVVVGTDRLRVTGPEGGLFEHSVE
TPLVKADPFQELRLESPTRSLSMDAPKGVHFKAHAGKIEALSQMDVIFHSHDGMLVLDAE
TVCLPKLEQGTWGPAGSLQRLYEICVCPDGKLYLSVAGMATTCPENSHVCL
NT seq 876 nt   +upstreamnt  +downstreamnt
atggtgcgtgaacagtacaccacaaccacagaaggcacccacgtagagaggccagagaac
caatgtgcctacaaaattggcatttatggctggagaaagcgttgcctctacttatttgtt
cttcttttactcatcattctccttgtgaattttggtcttacaatttggattcttaaagtg
atgtggttttccccaacaggaatgggtcacttgcgtgtcacaaatgacgggcttcgcctg
gaaggggaatctgaatttttatttccattgtacgccaaagaagtacactccagagtggac
tcatctctgcttctccagtctactcagaatgtgactgtaaatgcacgaaactctgaggga
gaggtcacaggcagattaaaagtgggtccccaaatggtagaagtccagagtcaacagttt
cagatcaattccaaggaaggcaaaccactcttcactgtagatgaaaaggaagttgtggtt
ggtacagacagacttcgagtaactggacctgaagggggtctttttgaacattcagtggag
acgcccctcgtaaaagccgacccatttcaggagctgaggttagaatctccaacacggagc
ctaagcatggatgccccaaagggtgttcattttaaagctcatgctgggaaaatcgaggcc
ctttcccaaatggatgtcatttttcacagtcatgatggaatgcttgtgcttgatgctgaa
actgtgtgtttacccaagttggaacaggggacgtggggtcctgctggcagcttgcaaaga
ctctatgaaatctgcgtgtgtccagatgggaagctttacctgtctgtggctggcatggcc
accacgtgccctgaaaacagccacgtctgtctctag

DBGET integrated database retrieval system