KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507669
Entry
107507669         CDS       T06036                                 

Gene name
ATP2A3
Definition
(RefSeq) sarcoplasmic/endoplasmic reticulum calcium ATPase 3 isoform X1
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray04919  Thyroid hormone signaling pathway
ray04972  Pancreatic secretion
ray05010  Alzheimer disease
ray05017  Spinocerebellar ataxia
ray05022  Pathways of neurodegeneration - multiple diseases
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107507669 (ATP2A3)
   04024 cAMP signaling pathway
    107507669 (ATP2A3)
   04022 cGMP-PKG signaling pathway
    107507669 (ATP2A3)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107507669 (ATP2A3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107507669 (ATP2A3)
   04261 Adrenergic signaling in cardiomyocytes
    107507669 (ATP2A3)
  09154 Digestive system
   04972 Pancreatic secretion
    107507669 (ATP2A3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107507669 (ATP2A3)
   05017 Spinocerebellar ataxia
    107507669 (ATP2A3)
   05022 Pathways of neurodegeneration - multiple diseases
    107507669 (ATP2A3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107507669 (ATP2A3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107507669 (ATP2A3)
   05414 Dilated cardiomyopathy
    107507669 (ATP2A3)
Enzymes [BR:ray01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     107507669 (ATP2A3)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Cation_ATPase Hydrolase_3 Cation_ATPase_N HAD DUF3106
Other DBs
NCBI-GeneID: 107507669
NCBI-ProteinID: XP_015994306
LinkDB
Position
Unknown
AA seq 1065 aa
MARPLWGSACAQRGGAAQPSPRPHSITQLSFVSSWLLWLLDPAELPTEEGKSLWELVLEQ
FEDLLVRILLLAAVVSFVLAWFEEGEETMTAFVEPLVIMLILVANAIVGIWQERNAESAI
EALKEYEPEMGKVIRSDRTGVQRIRARDIVPGDIVEVAVGDKVPADLRLIEIKSTTLRVD
QSILTGESVSVTKHTDAIPDPRAVNQDKKNMLFSGTNIASGKAVGVAVATGLHTELGKIR
SQMAAVEPERTPLQQKLDEFGRQLSRAISVICVAVWVINISHFADPAHGGSWLRGAVYYF
KIAVALAVAAIPEGLPAVITTCLALGTRRMARKNAIVRSLPSVETLGCTSVICSDKTGTL
TTNQMSVCRMFVVAEVEARTCRLHEFTVSGTTYAPEGEVRQGEQLVRCGQFDGLVELATI
CALCNDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFNTDLQALSRVERAGACNAVIK
QLMRKEFTLEFSRDRKSMSVYCSPTRPGPGAQGSKMFVKGAPESVIERCSSVRVGNRTVP
LNTTSREQILAKVRDWGSGSDTLRCLALATQDAPPRKEDMRLDDCSKFVQYETDLTFVGC
VGMLDPPRPEVAACIARCHQAGIRVVMITGDNKGTAVAICRRLGIFRDTEDVAGKAYTGR
EFDDLSPEQQRHACRTARCFARVEPAHKSRIVENLQSFNEVTAMTGDGVNDAPALKKAEI
GIAMGSGTAVAKSAAEMVLSDDNFASIVAAVEEGRAIYSNMKQFIRYLISSNVGEVVCIF
LTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKLPRNPREALISGWLFFR
YLAIGVYVGLATVAAATWWFLYDAEGPHITFYQLRNFLKCSEDNPLFAGIDCEVFESRFP
TTMALSVLVTIEMCNALNSVSENQSLLRMPPWLNPWLLAAVAMSMALHFLILLVPPLPLI
FQVTPLSGRQWVVVLQISLPVILLDEALKYLSRNHIDGTAGLQFIACQGPRAALITQRFS
LLTQALPTDLRLLTSGPTCPALPFVRGWEAPRSFAVDVGVGIWLS
NT seq 3198 nt   +upstreamnt  +downstreamnt
atggctagaccgttgtgggggtctgcgtgtgcacaaaggggaggggctgctcagccctct
ccaaggccccacagcataacccagttgtcttttgtctcttcatggctcctgtggctgctg
gatcccgcagagctcccaaccgaggaagggaagtccctgtgggagctggtgctggagcag
ttcgaggaccttctggtgcgcatcctgctgctggctgccgtggtctcctttgtcctggcc
tggtttgaggagggcgaggaaaccatgacagccttcgtggagcctttggtcatcatgctg
atcctcgtcgccaatgcaatcgtgggcatatggcaggaacgcaatgctgagagtgccatc
gaggccctgaaagagtatgagccggagatgggcaaggtgatccgctcggaccgcacgggc
gtgcagaggatccgtgcccgggacattgtccccggagacattgtggaagtggccgtggga
gacaaagtgcctgcagacctccgcctcattgagattaagtccaccacgttgagagtggac
cagtccatcttgacaggtgaatctgtgtctgtgaccaagcacacagatgccatcccagat
cccagagctgtgaaccaggacaagaagaacatgctattttctggcaccaatatcgcgtca
ggcaaggcagtgggtgtagcagtagccacaggcctgcacacagaactgggtaagatccgg
agccagatggcagctgtggagccagaacggacgccgttgcagcagaagctggacgaattt
gggcgacagctgtcccgcgccatctccgtgatctgcgtggccgtgtgggtcatcaacatc
agtcactttgccgacccggcccacggtggctcctggctccgcggcgcagtgtactacttc
aagattgccgtagccttggctgtggccgccatccccgagggcctcccggctgtcatcact
acatgcctggcactgggcacacggcgcatggcacgcaagaatgccatcgtgcggagtctg
ccctctgtggagaccctgggttgtacctcagtcatctgctctgacaagacgggcacactc
accaccaatcagatgtccgtctgccggatgttcgtggtagccgaggtggaagcaagaacc
tgccggttgcatgagttcactgtctcgggcaccacctatgctcctgagggcgaagtgcgg
cagggagagcagctggtgcgatgtgggcagttcgatgggctggtggagttggcgactatc
tgtgccctgtgcaatgactcggcgctggactacaacgaggccaagggcgtgtatgagaag
gtgggagaagccacggagacagccctgacttgcctagtggagaagatgaacgtgttcaac
actgacctgcaggccctgtcccgggtggagcgagctggcgcctgtaatgcggtcatcaag
cagctgatgcggaaggagttcaccctggagttctctcgagaccggaagtccatgtcagtg
tactgctcgcccactcgccctggcccaggtgcccaaggcagcaagatgtttgtgaagggg
gctcctgagagtgtgatcgagcgctgtagctcagtccgcgtagggaaccgcacagtaccc
ctgaacaccacctccagggagcagattctggccaaggtccgggattggggctcaggctcg
gacactctgcgctgcctggcactggccacccaggatgcgcccccgcggaaggaagacatg
cggctggacgactgcagcaagtttgtgcagtacgagacggacctgactttcgtgggctgc
gtgggcatgctggaccctccgaggcccgaggtggctgcctgcattgcacgctgccaccag
gcaggcatccgtgtggtcatgatcacaggggacaacaaaggcacagctgtggctatctgc
cgtcggcttggcatcttccgggacacggaggatgtggctggcaaggcctacacgggccgt
gagttcgacgacctcagccctgagcagcagcgccacgcctgccgcacggcccgctgcttc
gcccgtgtggaacccgcacacaagtctcgaatcgtggagaacctgcagtcctttaacgag
gtcactgccatgactggagatggagtgaacgatgccccggccctgaagaaagcagagatc
ggcattgccatgggctcgggcacagccgtggccaagtcagcggcagagatggtactgtca
gatgacaactttgcctccattgtggctgcggtggaggagggccgggccatctacagcaac
atgaagcagtttatccgctacctcatctcctccaatgtcggcgaggttgtctgcatcttc
ctcacggcaattctgggcctgccagaagccctgatccctgtgcagctgctctgggtgaac
ctggtgacagatggcctacctgccacagccctgggcttcaacccaccagacctggacatc
atggagaagctgcctcggaaccctcgcgaggcccttatcagtggttggctctttttcaga
tatctggctattggagtgtacgtcggcctggccacagtggctgctgccacctggtggttc
ctgtatgatgccgagggacctcacatcaccttctaccagctgaggaacttcctgaagtgc
tccgaggacaacccactctttgctggcattgactgtgaggttttcgagtcacgctttccc
acgaccatggccttgtctgtgttggtgaccattgaaatgtgcaacgccctcaacagcgtt
tcggagaaccaatcgctgctgcggatgccgccctggctgaacccctggctgctggcagct
gtggccatgtccatggctctgcacttcctcatcctgctggtgccgcccctgcccctcatt
ttccaagtgaccccactgagtgggcgccagtgggtagtggtgctccagatatctctgcct
gtcatcctgcttgatgaggctctcaagtacctgtcccggaaccacatagatggcacggct
ggcctacagttcattgcctgccaggggccaagagctgctctgatcacccaaagattctcc
ctactaacccaagcacttccaactgacctccgactcctgacttctggtcccacctgccct
gccctgcccttcgtaaggggctgggaagcccccagaagctttgctgtagacgtgggtgtt
ggcatctggctcagctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513235
Entry
107513235         CDS       T06036                                 

Gene name
ATP2A2
Definition
(RefSeq) sarcoplasmic/endoplasmic reticulum calcium ATPase 2
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray04919  Thyroid hormone signaling pathway
ray04972  Pancreatic secretion
ray05010  Alzheimer disease
ray05017  Spinocerebellar ataxia
ray05022  Pathways of neurodegeneration - multiple diseases
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107513235 (ATP2A2)
   04024 cAMP signaling pathway
    107513235 (ATP2A2)
   04022 cGMP-PKG signaling pathway
    107513235 (ATP2A2)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107513235 (ATP2A2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107513235 (ATP2A2)
   04261 Adrenergic signaling in cardiomyocytes
    107513235 (ATP2A2)
  09154 Digestive system
   04972 Pancreatic secretion
    107513235 (ATP2A2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107513235 (ATP2A2)
   05017 Spinocerebellar ataxia
    107513235 (ATP2A2)
   05022 Pathways of neurodegeneration - multiple diseases
    107513235 (ATP2A2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107513235 (ATP2A2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107513235 (ATP2A2)
   05414 Dilated cardiomyopathy
    107513235 (ATP2A2)
Enzymes [BR:ray01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     107513235 (ATP2A2)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 HAD
Other DBs
NCBI-GeneID: 107513235
NCBI-ProteinID: XP_016005152
LinkDB
Position
Unknown
AA seq 997 aa
MENAHTKTVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDL
LVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALK
EYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSIL
TGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMV
ATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCRMFILDKVEGDTCSLNEFTITGSTYAPLGEVHKDDKPVKCHQYDGLVELATICALC
NDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMK
KEFTLEFSRDRKSMSVYCSPNKPSRTSMSKMFVKGAPEGVIDRCTHIRVGSTKVPMTPGV
KQKIMSVIREWGSGSDTLRCLALATHDSPLRREDMNLEDSANFIKYETNLTFVGCVGMLD
PPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDEL
SPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKAEIGIAMG
SGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAAL
GFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRNPKEPLISGWLFFRYLAIG
CYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFEGVDCAIFESPYPMTMAR
SVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITP
LNLTQWLMVLKISLPVILMDETLKFVARNYLEPAILE
NT seq 2994 nt   +upstreamnt  +downstreamnt
atggagaacgcgcacacaaagacagtggaggaggtgctgggccacttcggggtcaacgag
agcacggggctgagcctggagcaagtcaagaagctcaaggagagatggggctccaacgag
ttaccagctgaagaaggaaaaactttgctggaacttgtgattgagcagtttgaagactta
ctagttagaattttattgctggccgcatgtatatcttttgttttggcttggtttgaagaa
ggtgaagaaacaattacagcctttgtagaaccctttgtaattttacttatattagtagcc
aatgcaattgtgggtgtatggcaggaaagaaatgctgaaaatgcaattgaagcccttaag
gagtatgagcctgaaatgggcaaagtatatcgacaggacagaaagagtgtacaacggatt
aaagctaaagacatcgttcctggtgatattgtggaaattgctgttggtgacaaagttcct
gctgatataagattaacttccatcaaatctactactctgagagtcgaccagtcaattctc
acaggtgaatctgtctctgtcatcaagcacactgaccctgtgcccgacccacgggctgtc
aaccaagacaagaagaacatgctcttttctggtacaaacattgctgctggcaaagccatg
ggagtagtggtggcaactggagttaacactgaaattggcaagatccgggatgaaatggtg
gcaacagaacaggagagaacccccctccagcagaaactggatgagtttggggaacagctt
tccaaagtcatctcccttatttgcattgcagtctggatcataaacattgggcacttcaat
gacccggttcatggaggctcctggatcagaggtgctatttactactttaaaattgcagtg
gccctggctgtagcagccattcctgaaggtctgcctgctgtcatcaccacctgcctggct
cttggaactcgcagaatggcaaagaaaaatgccatcgttcgaagcctcccttctgtggaa
acccttggttgtacttctgttatctgctcagacaagactggtacacttacaacaaaccag
atgtcagtctgcaggatgttcattctggacaaagttgaaggtgacacttgttcccttaat
gaatttactataactggatcaacatatgcacctcttggagaagtgcataaagatgataaa
ccagtaaaatgtcatcagtatgatggtcttgtagaattggcaacgatttgtgctctttgt
aatgactctgctttggattacaatgaggcaaagggtgtgtatgaaaaagttggagaagct
acagagactgccctcacttgcctggtagagaagatgaatgtatttgataccgaattgaag
ggtctttctaaaatagaacgagcaaatgcctgcaactcggtcattaaacagttgatgaaa
aaagaatttactctagagttttcacgtgatcgaaaatcaatgtcggtttattgttcaccg
aacaagccaagccggacatcaatgagcaaaatgtttgtgaagggtgctcctgaaggtgtt
attgacaggtgtacccacattcgagttggaagtacgaaagtccctatgacccctggagtc
aaacagaagatcatgtctgtcattcgggaatggggtagcggcagtgacacactgcgatgc
ctggctctggccactcacgacagcccgctgagaagagaggacatgaacctcgaggactct
gccaacttcattaaatatgagaccaatctgacttttgttggctgcgtgggcatgctggac
cctccaagaattgaagtggcctcttctgtgaagctgtgccggcaagcaggcatccgggtc
atcatgatcacgggggacaataagggcaccgctgtggccatctgtcgccgcattggcatt
ttcgggcaggatgaggatgtgacatcaaaggctttcacaggtcgagaatttgacgagctc
agcccttcagcccagagagatgcctgcttgaatgcccgctgtttcgctcgagtcgaacct
tcccacaaatctaaaattgtagaatttcttcagtcctttgatgagattaccgctatgact
ggggatggtgtgaacgatgcgcctgctctgaagaaagctgagatcggcatcgccatgggc
tctggcaccgcagtggcgaaaactgcctctgagatggttctggctgacgacaacttctcc
accatagtggctgccgtggaagaggggcgggccatctacaacaacatgaagcagttcatc
cgctacctcatctcgtcaaatgtgggagaagttgtctgtattttcctgacagcagccctt
ggatttcctgaggctttaattcctgtccagctgctctgggtcaatctggtgacagatggc
ctgcctgccactgcgctgggcttcaaccctccggatctggacatcatgagtaaaccaccc
cggaacccaaaggagccactcatcagcgggtggctcttctttcgctacctggctattggc
tgttacgttggcgctgctaccgtgggtgctgctgcgtggtggttcatcgctgccgacggc
ggtccacgagtgtctttctaccagctgagccatttcctacagtgtaaagaggacaacccg
gactttgaaggagtggattgtgcgatctttgaatccccatacccgatgacaatggcgcgc
tctgttctagtaaccatagagatgtgcaacgccctcaacagcttgtctgagaaccagtcc
ctgctgaggatgcccccgtgggagaacatctggctcgtgggctccatctgcctgtccatg
tcgctgcacttcctcatcctctacgtcgagcccttgccgcttatcttccagatcacaccg
ctgaatttgacccagtggctgatggtgctgaaaatctccttgcctgtgattctaatggat
gagacgctcaagtttgtggcccgcaactacctggaacctgcaatactggagtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515804
Entry
107515804         CDS       T06036                                 

Gene name
ATP2A1
Definition
(RefSeq) sarcoplasmic/endoplasmic reticulum calcium ATPase 1 isoform X1
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray04919  Thyroid hormone signaling pathway
ray04972  Pancreatic secretion
ray05010  Alzheimer disease
ray05017  Spinocerebellar ataxia
ray05022  Pathways of neurodegeneration - multiple diseases
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107515804 (ATP2A1)
   04024 cAMP signaling pathway
    107515804 (ATP2A1)
   04022 cGMP-PKG signaling pathway
    107515804 (ATP2A1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107515804 (ATP2A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107515804 (ATP2A1)
   04261 Adrenergic signaling in cardiomyocytes
    107515804 (ATP2A1)
  09154 Digestive system
   04972 Pancreatic secretion
    107515804 (ATP2A1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107515804 (ATP2A1)
   05017 Spinocerebellar ataxia
    107515804 (ATP2A1)
   05022 Pathways of neurodegeneration - multiple diseases
    107515804 (ATP2A1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107515804 (ATP2A1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107515804 (ATP2A1)
   05414 Dilated cardiomyopathy
    107515804 (ATP2A1)
Enzymes [BR:ray01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     107515804 (ATP2A1)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase_N Cation_ATPase Hydrolase Hydrolase_3 HAD
Other DBs
NCBI-GeneID: 107515804
NCBI-ProteinID: XP_016010456
LinkDB
Position
Unknown
AA seq 1000 aa
MEAAHSKTTEECLAYFGVSETTGLTLDQVKRHLEKYGPNELPAEEGKSLWELVIEQFEDL
LVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILVANAIVGVWQERNAENAIEALK
EYEPEMGKVYRADRKSVQRIKARDIVPGDIVEVAVGDKVPADIRILSIKSTTLRVDQSIL
TGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKALGIVATTGVSTEIGKIRDQMA
ATEQDKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWFRGAIYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCKMFIIDRVDGDVCILNEFSITGSTYAPEGEVLKNDKPVRAGQYDGLVELATICALC
NDSSLDFNEAKGVYEKVGEATETALTTLVEKMNVFNTEVRSLSKVERANACNSVIRQLMK
KEFTLEFSRDRKSMSVYCSPAKSRAAVGNKMFVKGAPEGVIDRCNYVRVGTTRVPLTGPV
KEKIMSVIKEWGTGRDTLRCLALATRDTPPKREDMILDDSSRFMEYEMDLTFVGVVGMLD
PPRKEVTGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFGENEEVADRAYTGREFDDL
PLAEQREACRRACCFARVEPAHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGIAMG
SGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAAL
GLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRPPRSPKEPLISGWLFFRYMAIG
GYVGAATVGAAAWWFLYAEDGPHVTYSQLTHFMQCTEDNPDFEGVDCEIFEAPEPMTMAL
SVLVTIEMCNALNSLSENQSLIRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLRA
LDFTQWLMVLKISLPVIGLDELLKFVARNYLEDPEDERRK
NT seq 3003 nt   +upstreamnt  +downstreamnt
atggaggctgcacactccaagaccacagaagaatgtttggcctattttggggtgagcgag
actacaggcctcaccttggaccaagttaagcggcatttggagaaatacggccccaacgag
ctccctgctgaggaagggaagtccctgtgggagttggtgattgaacagtttgaagacctc
ctggtacggatccttctcctggctgcctgcatttcctttgtgctggcctggtttgaggaa
ggtgaagagaccgtcactgcctttgttgaaccctttgtcatcctcttgatcctcgttgcc
aatgccatcgtgggggtttggcaggaacgtaatgcagagaatgccatcgaagctctgaag
gagtatgaacccgagatgggaaaagtctaccgggctgaccgaaagtcagtgcaaaggatc
aaggctcgggacattgtccccggggacattgtggaggtggctgtgggcgacaaagtccct
gcagatatccgcatcctctccatcaaatccaccaccctccgggttgaccagtccatcctg
acaggcgagtctgtatctgtcatcaagcacacagaccctgttcctgacccccgagctgtc
aaccaagataagaagaacatgcttttctcgggcaccaacattgcagccggcaaggccttg
ggcatcgtggccactactggtgtgagcactgagattgggaagatccgtgaccagatggcc
gccaccgagcaggacaagacccctctgcagcagaagctggacgagtttggggaacagctc
tccaaggtcatctccctcatctgcgtggccgtctggctcatcaacattggccacttcaac
gatcctgtccatgggggctcctggttccgtggtgccatctactactttaagattgccgtg
gccctggctgtggctgcgatcccggaaggccttcctgcggtcatcaccacctgcctggcc
ctgggcacccgccggatggcaaagaaaaacgcaatcgtgaggagcttgccctctgtggag
actctgggctgcacctctgtcatctgttctgacaagacaggcaccctcaccaccaaccag
atgtctgtctgcaagatgttcatcattgacagggtggatggcgacgtctgcattctgaat
gagttctcaatcactggttccacctatgctccagaaggagaggtcctgaagaatgataag
ccagtccgggcagggcagtatgatgggctggtggaactggccaccatttgtgccctctgc
aatgactcttctttggacttcaacgaggccaaaggtgtttatgagaaggtaggtgaggcc
accgagacggcactcaccaccttggtagagaagatgaatgtattcaataccgaagtgcga
agcctctcaaaggtggagagggccaatgcctgcaactcggtgatccgccagctaatgaag
aaggaattcaccctggagttctcccgagacagaaagtccatgtctgtctattgctcccca
gccaagtcccgggctgctgtaggcaacaagatgtttgtcaagggtgcccctgagggggtc
atcgaccgctgtaactacgtgcgagttggcaccacacgggtgcccctgacagggccagtg
aaggagaagatcatgtctgtgatcaaggagtggggcactggccgggacaccctgcgctgc
ctggccctggccacccgggacaccccgccaaagcgagaggacatgatcctggatgactct
tccaggttcatggagtatgagatggacctgacattcgttggcgtggtgggcatgttggac
ccaccccgcaaggaggtcacaggctctatccagttgtgccgtgatgccggaatccgagtg
atcatgatcactggggacaacaagggcacagccattgccatctgccgacgaatcggcatc
tttggagagaatgaggaggtggcagaccgagcctacactggccgggagttcgatgacctg
cccctggctgagcagcgggaggcctgccgtcgcgcctgctgctttgcccgagtggaacct
gcccataagtcgaagattgtggagtacctgcagtcttacgatgagatcacagctatgacc
ggcgatggtgtcaacgacgcccccgctctgaagaaagccgagatcggcattgctatgggc
tctggcactgctgtggccaagaccgcctctgagatggtgctggccgatgacaacttctcc
accatcgtggctgccgtggaggagggccgggccatctacaacaacatgaagcagttcatc
cgctacctcatctcctccaacgtgggcgaggtggtctgcatcttcctgacagctgccttg
gggctgcctgaagccttgattcctgtgcaactgctgtgggtgaacttggtgactgacggg
ctcccggccacagctctgggcttcaacccaccagacctggacatcatggaccggcccccc
cggagccccaaggagcccctcatcagtggctggctctttttccgctacatggcaattggg
ggctatgtgggtgcagccactgtgggtgcagctgcctggtggttcctgtacgcggaggac
gggcctcatgtcacctacagccagctgactcacttcatgcaatgcactgaagacaaccct
gactttgagggtgtggactgtgagatctttgaagctcccgagcccatgaccatggccttg
tctgtgctggttaccatcgaaatgtgcaatgctctcaacagcctgtctgagaaccagtct
cttatccggatgccgccctgggtgaacatctggctgctaggctccatctgcctctccatg
tccctccacttcctcatcctctacgttgaccctctgccgatgatcttcaagcttcgggcc
ctggacttcacccagtggctcatggtcctcaagatctcattgccagtcatcgggctcgat
gaactcctcaagtttgttgctcggaactatctggaggatccagaagatgaaagaaggaag
taa

DBGET integrated database retrieval system