KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507930
Entry
107507930         CDS       T06036                                 

Gene name
CBL
Definition
(RefSeq) E3 ubiquitin-protein ligase CBL
  KO
K04707  E3 ubiquitin-protein ligase CBL [EC:2.3.2.27]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04012  ErbB signaling pathway
ray04120  Ubiquitin mediated proteolysis
ray04144  Endocytosis
ray04910  Insulin signaling pathway
ray05100  Bacterial invasion of epithelial cells
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107507930 (CBL)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107507930 (CBL)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107507930 (CBL)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107507930 (CBL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107507930 (CBL)
   05205 Proteoglycans in cancer
    107507930 (CBL)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    107507930 (CBL)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    107507930 (CBL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107507930 (CBL)
   04121 Ubiquitin system [BR:ray04121]
    107507930 (CBL)
Enzymes [BR:ray01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     107507930 (CBL)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    107507930 (CBL)
Ubiquitin system [BR:ray04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    107507930 (CBL)
SSDB
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 UBA zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-rbx1 zf-C3HC4_4
Other DBs
NCBI-GeneID: 107507930
NCBI-ProteinID: XP_015994853
LinkDB
Position
Unknown
AA seq 917 aa
MAGNVKKSSGPGGGGGSGGSGGLIGLMKDAFQPHHHHHHHHLSPHPPGTVDKKMVEKCWK
LMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMEN
LMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRI
TKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEF
DIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLG
QWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHI
KVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRC
EIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDSLFMMKELAGAKVERP
PSPFSMAPQASLPPVPPRLDLLQQRVSIPSSASGLGTASKATSGSLHKDKPLPIPPTLRD
LPPPPPPDRPYSVAAETRPQRRPLPCTPGDCPSRDKLPPVPSSRVGELWLPRPIPKVPVV
APNPSDPWKGRELTNRHSLPFSLPSQMEPRIDVPRPGSTFNLDTSMNMNSSPLAGPECEH
SKIKPSASASAIYSLAARPLPVPKLPPGEQCEHEEDTEYMTPSSRPLGIQKPEGKWPLEI
TQSSQVCDCDQQIDSCTYEAMYNIQSQAAPSVTESSTFGEGNLVADHASTGPEESENDDD
GYDVPKPPVPAVLARRTLSDISNASSSFGWLSLEGDPTTNFTEGSQVPERPPKPYPRRIN
SERKTSSCQQGGAPAPAPAPAAAPSPQLSSEIENLMSQGYSYQDIQKALVIAHNNIEMAK
NILREFVSVSSPAHVAT
NT seq 2754 nt   +upstreamnt  +downstreamnt
atggctggcaacgtgaaaaagagctctgggcctggaggcggcggcggctccgggggctcg
ggcggcctgatcgggctcatgaaggacgccttccagccgcaccatcaccaccaccaccac
cacctcagcccccacccgcccgggacagtggacaagaagatggtggagaagtgctggaag
ctcatggacaaggtggtgcggttgtgtcaaaacccaaagctggcgctaaagaatagccca
ccttatatcttagacctgctgccagatacctaccagcatctccgcactatcttgtcaaga
tatgaggggaagatggagacacttggagaaaatgagtattttagggtgttcatggagaat
ttgatgaagaaaactaagcagacgataagcctcttcaaggaggggaaagaaagaatgtat
gaggagaattctcagcctaggagaaacctgactaaactgtccctgatcttcagccacatg
ctagcagaactaaaaggtatctttccaagtggactctttcaaggagacacatttcggatt
actaaagcagatgctgcagaattttggaggaaagcttttggggaaaagactatagtccct
tggaagagcttccgacaggctcttcatgaagtacatcccatcagttctgggctggaggcc
atggctctgaaatccactattgatctgacctgcaatgattatatttcagtttttgaattt
gacatctttacacgactctttcagccctggtcttctttgctcaggaactggaatagtctt
gctgtaactcatcccggttacatggctttcctgacgtatgatgaagtaaaagctcggctc
cagaaattcattcacaaacctggcagttacattttccggctgagctgtactcgtctgggt
cagtgggctattgggtatgtcactgctgatgggaacattcttcagacaatccctcacaat
aaacctctcttccaagcactgattgatggcttcagggaaggcttctatttgtttcctgat
ggacgaaatcagaatcccgacttgacaggcttatgtgaaccaactccccaggaccacatc
aaagtgacccaggaacaatatgaattatactgtgagatgggctccacgttccaactgtgt
aaaatatgtgctgaaaatgataaggatgtaaagattgagccatgtggacacctcatgtgc
acatcctgtcttacatcctggcaggaatcagagggccagggctgtcctttctgccgatgt
gaaattaaaggtactgaacccattgtggtagatccatttgatcctagaggaagtggcagc
ctattgaggcaaggagcagagggagctccttctccaaattatgatgatgatgatgatgag
cgagctgatgattctctcttcatgatgaaggaattagctggtgccaaggtggaacggcct
ccttctccattctccatggccccacaagcttcccttcccccagtgccaccacgacttgac
cttctgcaacaacgagtatctattccttcaagtgcttctggtcttggaactgcttctaag
gctacttctggctcccttcataaggacaagccattaccaatacctcccacacttcgagat
cttccaccaccaccccctccagaccggccttattctgttgcagcagaaacccggcctcag
agacgccctttgccttgtacaccaggcgactgtccatccagggacaaactgccccctgtc
ccttctagccgcgttggggaattatggctgcctcggccaatccccaaagtaccagtagtt
gctccaaaccctagtgacccctggaaagggagagaattaaccaaccggcactcacttcca
ttttcattaccctcacaaatggaacccagaatagatgtgcctaggcctggaagcacattc
aatctggatacctccatgaatatgaatagcagtccattagcaggtccagagtgtgagcac
tccaaaatcaaaccttctgcatctgccagtgccatttattctctggctgccagacctctt
cctgtgccaaagctgccacctggggagcagtgtgaacatgaggaggacacagagtatatg
actccctcctctaggcctctagggattcaaaagccagagggaaaatggcctttggagata
actcagagttcacaagtgtgtgattgtgaccagcagattgatagctgtacatatgaagca
atgtataatattcagtcccaggcagcgccatctgtgacagagagcagcacctttggtgaa
gggaatttggttgcagaccatgccagcactggccctgaggaatcagaaaatgatgatgat
gggtatgatgttcctaagccacctgtgccagcagtgctggcacgccgaactctgtcagat
atctctaatgccagctcctcctttggctggttgtctctggaaggcgatcccacaacaaac
ttcactgagggttcccaagttcctgagaggcctcccaagccataccctcggaggatcaat
tctgaacgaaaaaccagtagctgtcagcaaggtggtgctcctgctcctgctcctgctcct
gctgccgcgccctctcctcagctctccagtgagattgagaacctcatgagtcagggatac
tcctaccaggacattcagaaagctttggtcattgcccacaacaacattgaaatggccaaa
aatatcctccgggaattcgtttctgtttcttctcctgcccatgtggccacctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514119
Entry
107514119         CDS       T06036                                 

Gene name
CBLB
Definition
(RefSeq) E3 ubiquitin-protein ligase CBL-B isoform X1
  KO
K22517  E3 ubiquitin-protein ligase CBL-B [EC:2.3.2.27]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04012  ErbB signaling pathway
ray04120  Ubiquitin mediated proteolysis
ray04144  Endocytosis
ray04625  C-type lectin receptor signaling pathway
ray04660  T cell receptor signaling pathway
ray04910  Insulin signaling pathway
ray05162  Measles
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107514119 (CBLB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107514119 (CBLB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107514119 (CBLB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107514119 (CBLB)
   04660 T cell receptor signaling pathway
    107514119 (CBLB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107514119 (CBLB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    107514119 (CBLB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107514119 (CBLB)
   04121 Ubiquitin system [BR:ray04121]
    107514119 (CBLB)
Enzymes [BR:ray01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     107514119 (CBLB)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    107514119 (CBLB)
Ubiquitin system [BR:ray04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    107514119 (CBLB)
SSDB
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-rbx1 zf-C3HC4_4 UBA zf-RING_4
Other DBs
NCBI-GeneID: 107514119
NCBI-ProteinID: XP_016006983
LinkDB
Position
Unknown
AA seq 987 aa
MEEDMANSVNGRNPGGRGGNPRKGRILGFIDAIQDAVGPPKQAAADRRTVEKTWKLMDKV
VRSCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMK
KSKRAIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKA
DAAEFWRKFFGDKTIVPWKIFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIF
TRLFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWA
IGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVT
QEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIK
GTEPIIVDPFDPRDEGSRCCSIIDPFGMPMLDLDDDDDREESLMMNRLANVRKCTDRQNS
PVTSPGSSPLAQRRKPQPDPLQIPHLSLPPVPPRLDLIQKGIVRSPCGSPTGSPKSSPCM
VRKQDKPLPAPPPPLRDPPPPPPERPPPIPPDNRLSRHFHHVESVPSRDQPMPLEAWCPR
DIFGTNQSVGCRLLGDGSPKPGITASSNVNGRHSRMSSDPVLMRKHRRHDLPSEGAKVLS
NGHLGSEEYDIPPRLSPPPPATSLIPSIRCTGPLANSLSEKTRDSVEEADDEYKIPSSHP
VSLNSQPSHCHNVKTPLRSCDNGHCILNGTHGTSSEMKKSNTPELGIYVKGDVFDSTSDP
VPLPPARPPTRDNPKHGSSLNRTPSDYDLLIPPLGEDAFDALPPSLPPPPPPARHSLIEH
SKPPGSGSRPSSGQDLFLLPSDPFFDPASGQVPLPPARRLPGENVKSNRTSQDYDQLPSS
SDGSQAPARPPKPRPRRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGYAFEEVKRALEI
AQNNVEVARSILREFALPPPVSPRLNL
NT seq 2964 nt   +upstreamnt  +downstreamnt
atggaggaggatatggcaaattctgtgaatggcagaaaccctggtggtcgaggaggaaac
ccccgaaaaggacgaattttgggttttatcgatgctattcaggatgcagttggaccccct
aagcaagcagcagcagatcggcggactgtggaaaaaacttggaaactcatggacaaagtg
gtcagatcgtgccaaaatcccaaacttcagttgaaaaatagcccaccgtatatacttgat
attttacctgatacatatcagcatttgcgacttatattgagtaaatacgatgacaaccag
aaacttgcccaactcagtgagaatgaatattttaaaatctacattgatagtctaatgaaa
aagtcaaaacgggcaataagactctttaaagaaggcaaagagaggatgtatgaagaacaa
tcgcaggacaggcgaaatctcacaaaactgtcccttatcttcagtcacatgctggcagaa
atcaaagcaatctttcccaatgggcagttccagggagataactttcgtatcacgaaagca
gatgctgctgaattctggagaaagttttttggagacaaaactattgtaccatggaaaata
ttcagacagtgccttcatgaggtccatcaaattagctctggcctggaagcaatggctcta
aaatcaacaattgatttaacttgtaatgattatatttcggtttttgaatttgatattttt
actaggctatttcagccgtggggctctattttgcggaattggaatttcttagccgtaacg
catccaggttacatggcatttctcacatacgatgaagttaaagcccgactgcagaaatac
agcaccaaacctggaagctacattttccggttaagctgcactagattgggacagtgggcc
attggttatgtgacaggggatggcaatattttgcagaccatacctcataacaagccctta
tttcaagccctgattgatggtagcagagaaggattctacctttatcctgatgggaggagt
tataatcctgatttaactggattatgtgaacctacaccccatgatcatataaaagttaca
caggaacaatatgaattatattgtgaaatgggctccacttttcagctctgtaaaatttgt
gctgagaacgacaaagatgtcaagattgagccttgcgggcatttgatgtgcacctcttgc
cttacagcatggcaggagtcagacggccagggctgccccttctgtcgctgtgaaataaaa
ggaacagagcccataatcgtagacccctttgacccaagagatgaaggctccaggtgctgt
agcatcattgaccccttcggaatgccaatgctggacttggatgacgacgacgaccgagag
gagtccttgatgatgaatcggttggcaaatgttcgaaagtgcactgacaggcagaattca
ccagtcacatcaccagggtcctcccctctggcacagagaagaaagccacagccggaccct
ctccagatcccacatctgagcctgccacccgtgcctcctcgcctggacctaattcagaaa
ggcatagttcggtctccctgtggcagcccaactggttcaccaaagtcttctccttgcatg
gtgagaaaacaagataaaccactcccagcaccacctcctcctttaagagatcctcctccc
cctccacctgagagacctccccctatcccacctgacaatagactgagccgtcacttccat
catgtggagagtgtgccttccagagaccagccaatgcctcttgaagcctggtgccctcga
gatatatttgggactaatcagtcggtgggatgtcgcctcctaggagatggctctccgaag
cctggaatcacagcaagttcaaatgtaaatggaagacacagtagaatgagctctgaccca
gtgcttatgcggaaacacagacgccatgatttgccttcagaaggagccaaggtcctttcc
aatggtcaccttggaagtgaagaatatgatattcctccccggctttctcctcctcctcca
gctacctcccttattcctagcatcaggtgtactggtccattagcaaattctctttcagag
aaaacaagagactcagtagaggaagctgatgatgaatacaagattccttcatcccatcct
gtttccctgaattcacaaccatctcattgtcataatgtaaaaactcctcttaggtcttgt
gataatggtcattgtatattgaatggaacacatggtacatcttcagagatgaagaaatca
aacacccctgagttaggcatatatgtaaaaggagatgtttttgattcaacctctgatcca
gtgccattaccacctgccaggcctccaactcgggacaatccaaagcatggttcttcactc
aacaggacgccctctgattatgatcttctcatccctccattaggtgaagatgcttttgat
gcccttcccccatcccttccacctcccccacctcctgcaaggcatagtctcatcgaacat
tcaaaacctcctggctccggtagccggccatcctcaggacaggaccttttccttcttcct
tcagatcctttttttgatccagcaagtggccaagttcctttgcctcctgcaaggagatta
ccaggtgaaaacgtcaaatccaacaggacatcacaagactatgatcagctgccttcatca
tcagatggttcacaagcaccagccagacctcctaaaccacgaccccgtaggactgcacca
gaaattcaccacagaaaaccccatgggccggaggcagcattggaaaatgtcgatgcaaaa
attgcaaaactaatgggagagggttatgcctttgaagaggtgaagagagccttagaaata
gcccagaataatgttgaagtggcccgtagcatcctccgggaatttgccttaccccctcca
gtctcccctcgcctaaatctatag

DBGET integrated database retrieval system