KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508019
Entry
107508019         CDS       T06036                                 

Definition
(RefSeq) calcitonin receptor-stimulating peptide 3-like
  KO
K12332  calcitonin
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107508019
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107508019
SSDB
Motif
Pfam: Calc_CGRP_IAPP
Other DBs
NCBI-GeneID: 107508019
NCBI-ProteinID: XP_015994985
LinkDB
Position
Unknown
AA seq 180 aa
MGFWKYSPFLALGILVLYQAGVLQAAPFRAISSRHLDSASLTEKELCLLLAAMVRDYAQK
KIHELEQETGRFSITTQKRACNTATCVTNNLVDMLSKYGSLLKQGFLPIKLGPNSFGRRR
RDDEKRATGICEHFVDQADSDEAKILQVELPKDLHLQELHHLDNESLKYLKTSGMATGYR
NT seq 543 nt   +upstreamnt  +downstreamnt
atgggcttctggaagtactccccttttctggctcttggtatcttggttttgtaccaggca
ggtgtcctccaggcagcaccattcagggctatttcgtctcgccacctcgattctgcttcg
ctcactgagaaggaattgtgcctcctactggctgcaatggtgagggactatgcgcagaaa
aagatccatgagctggagcaggagacagggagattcagcatcactacccagaagagagcc
tgcaacactgccacctgtgtgaccaataacctggtagatatgctgagcaaatatgggagt
ttattgaagcaaggcttcctgcccatcaaactaggccccaattcctttggccgtcgccgc
agggatgatgagaagagagccacagggatctgtgaacactttgttgaccaggctgactcg
gacgaggcaaagattcttcaggttgagttgcccaaggaccttcatctccaggagttgcat
cacctggataatgaatcgctcaaatacctgaagacttctgggatggccaccggttatcgg
tga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508021
Entry
107508021         CDS       T06036                                 

Gene name
CALCB
Definition
(RefSeq) calcitonin gene-related peptide 2 isoform X1
  KO
K12332  calcitonin
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107508021 (CALCB)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107508021 (CALCB)
SSDB
Motif
Pfam: Calc_CGRP_IAPP
Other DBs
NCBI-GeneID: 107508021
NCBI-ProteinID: XP_015994987
LinkDB
Position
Unknown
AA seq 140 aa
MGFWKSSPFLAFSILVLCQAGGLQAAPFRSSLESLPDPAALSEKEGRLLLAALVNAYVQR
KTNELDQEQETEGSSLDISRAKRCSNLSTCVLSTYSKDLSNFHMFSGIRFGAETPGKKRD
IASSLERKPYPHFGVPQDAN
NT seq 423 nt   +upstreamnt  +downstreamnt
atgggcttctggaagtcctctcccttcttggctttcagcatcttggtcctgtgccaggca
ggcggcctccaggcggcaccatttaggtcgtctttggagagcctcccggacccggctgca
ctcagtgagaaggaagggcgcctcctactggctgcactggtgaatgcctatgtgcagagg
aagaccaatgagctggaccaagagcaggagacagagggctccagcctggacatctccaga
gctaagcggtgcagtaatctgagtacctgcgtgctgagcacatactcgaaggacctgagc
aactttcatatgttctctggcatccgcttcggggctgaaacacctggcaagaaaagggat
atagccagcagcttggagaggaaaccctacccccactttggggtgccccaggatgccaac
tga

DBGET integrated database retrieval system