KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508030
Entry
107508030         CDS       T06036                                 

Gene name
ABCC8
Definition
(RefSeq) ATP-binding cassette sub-family C member 8 isoform X1
  KO
K05032  ATP-binding cassette subfamily C (CFTR/MRP) member 8
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray02010  ABC transporters
ray04911  Insulin secretion
ray04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    107508030 (ABCC8)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107508030 (ABCC8)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107508030 (ABCC8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107508030 (ABCC8)
Transporters [BR:ray02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC8, 9 subgroups
    107508030 (ABCC8)
SSDB
Motif
Pfam: ABC_membrane ABC_tran MTABC_N SMC_N AAA_29 ABC_ATPase RsgA_GTPase AAA_25 Zeta_toxin
Other DBs
NCBI-GeneID: 107508030
NCBI-ProteinID: XP_015995002
LinkDB
Position
Unknown
AA seq 1636 aa
MPLAFCGNENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGWGSQSSKVHI
HHSTWLHFPGHNLRWILTFMLLFILVCEIAEGILSDGVTESRHLHLYMPAGMAFMAAVTS
VVYYHNIETSNFPKLLIALLVYWTLAFITKTIKFVKFYDHDIGFSQLRFCLTGLLVILYG
MLLLVEVNVIRVRRYIFFKTPREVKPPEDLQDLGVRFLQPFVNLLSKGTYWWMNAFIKTA
HKKPIDLRAIGKLPIAMRALTNYRRLREAFDVQAQKDTHSPQGARAIWRALCHAFGRRLV
LSSTFRILADLLSFAGPLCIFGIVDHLGKENRVFQPKTQFLGVYFVSSQEFLANAYVLAV
LLFLALLLQRTFLQASYYVAIETGINLRGAIQTKIYNKIMHLSTSNLSMGEMTAGQICNL
VAIDTNQLMWFFFLCPNLWAMPVQIIVGVILLYYILGVSALIGAAVIILLAPVQYFVATK
LSQAQRSTLEYSNERLKQTNEMLRGIKLLKLYAWENIFCTRVEMTRKKEMTSLRAFAIYT
SISIFMNTAIPIAAVLITFVGHVIFFKEVDCSPSVAFASLSLFHILVTPLFLLSSVVRST
VKALVSVQKLSEFLSSAEIREEQCAPREPAPQGQTSKYQAVPLKVVNRKCPAREDCQGFM
GPPQRLAPSADGDADNCCVQVIGGFFTWTPDGIPTLSNVTIRIPRGQLTMIVGQVGCGKS
SLLLATLGEMQKIAGAVFWNSSLPDSETGEDPSPEREPAADVDVRRRGPVAYASQKPWLL
NATVEENITFESPFNKQRYKMVIEACSLQPDIDILPHGDQTQIGERGINLSGGQRQRISV
ARALYQHTNVIFLDDPFSALDIHLSDHLMQAGILELLRDDKRTVVLVTHKLQYLPHADWI
IAMKDGTIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVMERKVPEPPQGLPRAM
SSRDGLLQYEEEEEEEAAESEEEDNLSSVLHQRAKIPWRACAKYLSSAGILLLSLLIFSQ
LLKHMVLVAIDYWLAKWTDSVLTLSPMTRNCSLSQECSLDQTVYAMVFTVLCSLGIVLCL
VTSVTVEWTGLKVAKRLHRSLLNQIILAPMRFFETTPLGSILNRFSSDCNTIDQHIPSTL
ECLSRSTLLCVSAVAVISYVTPVFLVALLPLAIVCYFIQKYFRVASRDLQQLDDTTQLPL
LSHFAETVEGLTTIRAFRYETRFQQKLLEYTDSNNIASLFLTAANRWLEVRMEYIGACVV
LIAAVTSISNSLHRELSAGLVGLGLTYALMVSNYLNWMVRNLADMEIQLGAVKRIHGLLK
TEAESYEGLLAPSLIPKNWPDQGKIQIQNLSVRYDSSLKPVLKHVNALISPGQKIGICGR
TGSGKSSFSLAFFRMVDMFEGRIIIDGIDIAKLPLHTLRSRLSIILQDPVLFSGTIRFNL
DPERKCSDSTLWEALEIAQLKLVVKALPGGLDAIITEGGENFSQGQRQLFCLARAFVRKT
SIFIMDEATASIDMATNQTGPQLLAPGGSANSCCSHLAGKHPPEGGDDSLRRPYRGHHRG
KGPVGGVQGDTWTQGWLSEVIISEQPLRSLGPGNQEFSPARPSQLPSHSPGSKAPFCPKA
LRARLGLLLHRKRGMG
NT seq 4911 nt   +upstreamnt  +downstreamnt
atgcccctggccttctgcggcaatgagaatcactcggccgcctaccgggtggaccagggc
gtcctcaacaacggctgcttcgtggacgcgctcaacgtggtgccgcacgtcttcctgctc
ttcatcaccttccccatcctcttcatcggatggggcagtcagagctccaaggtacacatc
caccacagcacatggctccacttccctgggcacaacttacgctggatcctgaccttcatg
ctgctcttcatcctggtgtgtgagatcgcagagggcatcctgtctgatggagtgaccgaa
tcccgccatctccacctgtacatgccagccgggatggcgttcatggctgctgtcacctcc
gtggtctactatcacaacattgagacctccaacttccccaagctgctgatagccctgctg
gtgtactggaccctggcctttatcaccaagaccatcaagtttgtcaagttctatgaccac
gacatcggcttctcgcagctgcgcttctgcctcacggggctgctggtcatcctctacggc
atgctgctgctcgtggaggtcaacgtcatcagggtgaggagatacatcttcttcaagacg
ccaagagaggtgaagccccctgaagacctgcaggacctgggggtgcgcttcctgcagccc
ttcgtgaacctgctgtccaaaggcacctactggtggatgaacgccttcatcaagactgcc
cacaagaagcccattgatctccgagccatcgggaagctgcccatcgccatgagggccctc
accaattaccggcggctccgcgaggccttcgatgtccaagcgcagaaggacacgcatagt
cctcagggtgcccgggccatctggcgggcactctgccacgcctttgggagacgcctggtc
ctcagcagcactttccggatcctggccgacctgctgagcttcgcagggcctctgtgcatc
tttggaattgtggaccatcttgggaaggagaaccgagtcttccagcccaagacacagttt
ctcggagtttactttgtctcatctcaagagttccttgctaatgcctacgtcttagctgtg
cttctgttccttgccctcctactgcaaaggacatttctgcaagcatcctactacgtcgcc
attgaaaccggaattaacttaagaggagcaatacagaccaagatttacaataaaattatg
cacctgtccacctccaacctatccatgggggaaatgactgccgggcagatctgtaacctg
gttgccatcgacaccaaccagctcatgtggtttttcttcttgtgcccaaacctctgggct
atgccagtacagatcatcgtgggtgtgattctcctttactacatcctcggagtcagcgcc
ttaatcggggcagctgtcatcatcctgctggcccccgtccagtacttcgtggccaccaag
ctctctcaggcccagcggagcaccctggagtattccaacgagaggctgaagcagaccaac
gagatgctccgtggcatcaagctgctcaagctctacgcctgggagaacatcttctgcaca
cgggtggagatgacccgcaagaaggagatgaccagcctcagagcctttgccatctacact
tccatctccattttcatgaacacagccatccccattgcagccgtcctcatcaccttcgtg
ggccacgttatcttcttcaaagaggtggactgttcgccgtctgtggccttcgcctccctc
tccctcttccacatcctggtcacaccactgttcctgctgtccagtgtggtccggtcgaca
gtcaaagctctggtcagcgtgcaaaagctgagcgagttcttatccagtgcagagatccgg
gaggagcagtgtgctccccgggagcccgcgccccagggccaaactagcaaataccaggca
gtgcccctcaaggttgtgaaccgcaagtgtccagcccgagaagactgtcagggtttcatg
ggtccaccgcagaggctggcccccagtgcagatggggatgctgacaattgctgtgtccag
gtcattggaggcttcttcacatggacccccgatggaatccccacactgtccaacgtcacc
atccgcatcccccgaggccagctgaccatgatcgtgggacaggtgggctgtggcaaatcc
tcgctcctccttgccaccctgggggagatgcagaagatcgcaggggccgtcttctggaac
agcagccttcccgacagtgagacaggagaggaccccagcccagagcgggagccagcagcc
gatgtggatgtcaggaggagaggccctgtggcctatgcttctcagaaaccatggctgcta
aatgccactgtggaggaaaatatcactttcgagagtcccttcaacaaacaacggtacaag
atggtcatcgaagcctgctccctgcagccagacatcgacatcctgccccatggagaccag
actcagattggggaacggggcatcaacctgtctggtggtcagcgccagcgaatcagtgtg
gcccgagccctctaccagcataccaatgtcatcttcttggatgaccccttctcagctctg
gatatccatctgagtgaccacctgatgcaggccgggatccttgagctactccgagatgat
aagaggacagtagtccttgtgacccacaagctacagtacctgccacatgccgactggatc
attgctatgaaggatggcaccatccagagggagggcacactcaaggacttccagaggtct
gagtgccagctctttgaacactggaagactctcatgaaccggcaagaccaagagctggag
aaggagactgtcatggagagaaaagtcccagagccaccccagggcctgccccgggccatg
tcctcgagagatggcctcctgcagtatgaggaagaagaggaagaggaggcagccgagagt
gaggaggaggacaacctgtcgtcggtgctgcaccagcgtgccaaaatcccgtggcgagcc
tgcgccaagtatctgtcgtctgccggcatcttgctcctgtcgctgctcatcttctcgcag
ctgctcaagcacatggttttggtggccatcgactactggctggccaagtggaccgacagc
gtcctgaccctgagccccatgaccaggaactgctccctcagccaggagtgctccctcgac
cagaccgtctacgccatggtgttcacggtgctctgcagcctgggcatcgtgctgtgtctg
gtcacatctgtcacagtagagtggacagggctgaaggtggccaagaggttgcatcgcagc
ctgctgaaccagatcatcctggctcccatgaggttttttgagaccacaccccttggaagc
atcctgaacagattttcctctgattgtaatactatcgaccagcacatcccatccacgctg
gagtgcctgagccgatccactctgctctgtgtctcagccgtggccgtcatctcctatgtc
acacctgtgttcctcgtggccctcttgcccctggccatcgtgtgctacttcatccagaag
tacttccgggtagcatccagggacctgcagcagctggatgacaccacccagctcccactg
ctctcgcactttgctgaaactgtggaaggcctcaccaccatccgggccttcaggtacgag
acccggttccagcagaagctcctcgaatacacggactccaacaacatcgcctccctcttc
ctcacagctgccaatagatggctagaagtccgcatggagtacattggtgcatgtgtggtc
ctcatcgcagctgtgacttccatctccaactccctgcacagggagctctctgctggcttg
gtgggtctgggcctcacctatgccttaatggtctccaactacctcaactggatggtgagg
aacctggcagacatggagatccagctgggggccgtgaaacgcatccatgggctcctgaaa
actgaggcagagagctacgaggggctgctggcaccatcactgatcccgaagaactggccg
gaccaggggaagatccagatccagaacctgagtgtgcgctacgacagctccctgaagccc
gtgctgaagcatgtcaacgccctcatctccccgggacagaagattgggatctgtggccgc
acaggcagtgggaagtcttccttctctctcgccttcttccgcatggtggacatgttcgaa
gggcgcatcatcattgatggcattgacatcgccaaactgccgctgcacaccctgcgctca
cgactctccatcatcctgcaggacccagtgctcttcagcggcaccatccgatttaacctg
gacccagagaggaagtgctctgacagcacactgtgggaggccctggagatagcccagttg
aagctggtggtgaaggcgctgccgggaggcctcgatgccatcatcacagaaggtggggag
aatttcagccaaggccagaggcagctgttctgcctggcacgagccttcgtgaggaagacc
agcatcttcatcatggatgaggccacggcttccatcgacatggccacgaaccagactgga
ccccaactactggcaccaggcgggtcagccaacagctgctgctcccacctggcaggaaaa
catcctccagaaggtggtgatgacagccttcgcagaccgtaccgtggtcaccatcgcggt
aaggggcccgttggtggggtgcagggggatacctggacgcagggctggctttctgaggtc
atcatcagtgagcagcccctgagatcacttgggcctggtaaccaagagttttcgcctgca
cgtccatcacaactcccctctcattctccaggttccaaagcccccttctgtcccaaggcc
ttgagagctaggctggggttacttctccataggaaacggggaatggggtga

DBGET integrated database retrieval system