KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508032
Entry
107508032         CDS       T06036                                 

Gene name
KCNJ11
Definition
(RefSeq) ATP-sensitive inward rectifier potassium channel 11
  KO
K05004  potassium inwardly-rectifying channel subfamily J member 11
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04911  Insulin secretion
ray04929  GnRH secretion
ray04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107508032 (KCNJ11)
   04929 GnRH secretion
    107508032 (KCNJ11)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107508032 (KCNJ11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107508032 (KCNJ11)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   107508032 (KCNJ11)
SSDB
Motif
Pfam: IRK_C IRK EI24
Other DBs
NCBI-GeneID: 107508032
NCBI-ProteinID: XP_015995015
LinkDB
Position
Unknown
AA seq 395 aa
MLSRKGIIPEEYVLTRLAEDPAEPRYRARERRARFVSKNGNCNVAHKNIREQGRFLQDVF
TTLVDLKWPHTLLIFTMSFLCSWLLFAMVWWLIAFAHGDLAPGNLAPSEGTIVPCVTSIH
SFSSAFLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAH
RRAETLIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQ
VDIPMENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTG
ITTQARTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTVKVPTPLCTARQLDEDRSL
LDALTLASARGPLRKRSVAVAKAKPRFSISPDSLS
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgctgtcccgaaagggcatcatccctgaggagtatgtgctgacgcgactggcagaagac
cctgcagagccccggtaccgtgcgcgtgagcgaagggcccgcttcgtgtccaagaacggc
aactgcaacgtggcccacaagaacatccgggagcagggccgcttcctgcaggatgtgttc
accacgctggtggacctcaagtggccgcacacgctgctcatcttcaccatgtccttcctg
tgcagctggctgctcttcgccatggtctggtggctcatcgccttcgcccacggtgacctg
gcccctggcaacctggcccccagcgagggcaccattgtgccctgcgtcaccagcatccac
tctttttcgtctgccttccttttctctattgaagtccaagtgaccattggttttggaggg
cgcatggtgactgaggagtgcccattggccatcttgatcctcatagtgcagaacattgtg
gggctcatgatcaatgccatcatgctgggctgcatcttcatgaagactgcgcaggcccac
cgaagggctgagaccctcatcttcagcaagcacgcggtcatcgccttgcgccatggccgc
ctctgcttcatgctgcgcgtgggcgaccttcgcaagagcatgatcatcagcgccaccatc
cacatgcaggtggtgcgcaagaccaccagccccgagggcgaggtggtgcccctccaccag
gtggacatccctatggagaacggcgtgggtggcaacagcatcttcttggtggctcccctc
atcatctaccacgtcatcgatgccaacagcccgctctacgacctggcgcccagtgacctg
caccaccatcaggacctcgagatcatcgtcatcctggaaggtgtggtggaaaccacaggc
atcaccacccaagcccgcacctcctacctggccgacgagatcctgtggggccagcgcttt
gtgcccattgtggctgaggaggatggccgctactccgtggactactccaagtttggcaac
accgtcaaagtgcccacgccactctgcacagcccgccagcttgatgaggaccgcagcctg
ctggacgccctaacccttgcttctgcccgtgggccactgcgcaagcgcagcgtggccgtg
gccaaggccaagcccaggtttagcatctctccagattccctgtcctga

DBGET integrated database retrieval system