KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508080
Entry
107508080         CDS       T06036                                 

Gene name
ACTC1
Definition
(RefSeq) actin, alpha cardiac muscle 1
  KO
K12314  actin, alpha cardiac muscle
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray05410  Hypertrophic cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107508080 (ACTC1)
   04261 Adrenergic signaling in cardiomyocytes
    107508080 (ACTC1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107508080 (ACTC1)
   05414 Dilated cardiomyopathy
    107508080 (ACTC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107508080 (ACTC1)
   04147 Exosome [BR:ray04147]
    107508080 (ACTC1)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     107508080 (ACTC1)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   107508080 (ACTC1)
  Exosomal proteins of bladder cancer cells
   107508080 (ACTC1)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 107508080
NCBI-ProteinID: XP_015995095
LinkDB
Position
Unknown
AA seq 377 aa
MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK
MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL
DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK
SYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV
LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS
KQEYDEAGPSIVHRKCF
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgtgcgacgacgaggagaccaccgccctggtgtgcgacaacggctccgggctggtgaag
gccggcttcgcgggcgacgatgcgcctcgcgcggtcttcccgtccatcgtgggccgcccg
cgccaccagggcgtcatggtgggtatgggtcagaaggattcctacgtaggagatgaggcc
cagagcaagcgaggtatcctgactctcaaataccccatcgagcacggcatcatcaccaac
tgggacgacatggaaaagatctggcatcataccttctacaatgagctccgcgtagcccct
gaggagcaccctactctcctcactgaggccccactgaaccccaaggccaaccgtgagaag
atgacccaaatcatgtttgagaccttcaatgtccccgccatgtacgtggctatccaggcg
gtgctgtccctgtatgcttctggccgtaccacaggcattgttctggactctggggatggt
gtaactcacaatgtccccatctatgaaggctacgctttgccccatgccatcatgcgtctg
gatctagctggtcgggatctcactgactacctcatgaagatcctcactgagcgtggctac
tcctttgtcaccaccgctgaacgtgaaattgtccgtgacattaaggagaagctgtgctat
gttgccctggattttgagaatgagatggccacggctgcttcttcctcctccctggagaag
agctatgaactgcctgacggccaagtcatcactattggcaacgagcgcttccgctgccct
gagacgctcttccagccctccttcatcggtatggaatctgctggcatccatgaaacgact
tataatagcatcatgaagtgtgacattgatatccgcaaggacctgtatgccaacaatgtc
ttatccggaggtaccaccatgtaccctgggattgctgatcgcatgcaaaaagaaatcact
gcactggctcccagcaccatgaagattaagattattgccccccctgagcgtaagtactct
gtttggattgggggctccatcctggcctccctgtctaccttccagcagatgtggattagc
aagcaagagtatgatgaagcaggcccctccatcgtccaccgcaaatgcttctaa

DBGET integrated database retrieval system