KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508174
Entry
107508174         CDS       T06036                                 

Gene name
NSF
Definition
(RefSeq) vesicle-fusing ATPase
  KO
K06027  vesicle-fusing ATPase [EC:3.6.4.6]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04721  Synaptic vesicle cycle
ray04727  GABAergic synapse
ray04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107508174 (NSF)
  09156 Nervous system
   04727 GABAergic synapse
    107508174 (NSF)
   04721 Synaptic vesicle cycle
    107508174 (NSF)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.6  vesicle-fusing ATPase
     107508174 (NSF)
Membrane trafficking [BR:ray04131]
 SNARE
  SNARE associated proteins
   Others
    107508174 (NSF)
SSDB
Motif
Pfam: AAA CDC48_N CDC48_2 AAA_lid_3 AAA_22 AAA_16 RuvB_N RNA_helicase AAA_2 AAA_14 AAA_18 AAA_5 AAA_33 TIP49 Mg_chelatase AAA_24 ATPase_2 TsaE NACHT AAA_17 ABC_tran AAA_28 ATPase IstB_IS21 NB-ARC AAA_3 AAA_7 Rad17
Other DBs
NCBI-GeneID: 107508174
NCBI-ProteinID: XP_015995310
LinkDB
Position
Unknown
AA seq 752 aa
MAGRSMQAARCPTDELSLTNCAVVNEKDFQSGQHVIVRTSPNHRYTFTLRTHPSVVPGSI
AFSLPQRKWAGLSIGQEIEVSLYTFDKAKQCIGTMTIEIDFLQKKSIDSNPYDTDKMAAE
FIQQFNNQAFSVGQQLVFSFNEKLFGLLVKDIEAMDPSILKGEPASGKRQKIEVGLVVGN
SQVAFEKAENSSLNLIGKAKTKENRQSIINPDWNFEKMGIGGLDKEFSDIFRRAFASRVF
PPEIVEQMGCKHVKGILLYGPPGCGKTLLARQIGKMLNAREPKVVNGPEILNKYVGESEA
NIRKLFADAEEEQRRLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTVVNQLLSKIDG
VEQLNNILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPDEKGRLQILHIHTARMRGHQLL
SADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIKASTKVEVDMEKAESLQVTRGDF
LASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVL
LEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCV
VVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNA
FSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQM
DPEYRVRKFLALLREEGASPLDFESGLFANTQ
NT seq 2259 nt   +upstreamnt  +downstreamnt
atggcgggccggagtatgcaagctgcgagatgtcctacagatgaattatctttaaccaac
tgtgcagttgtgaatgaaaaagatttccagtctggccagcacgtgattgtgaggacctct
cccaaccataggtacacatttacactgaggacccatccgtcagtggtcccaggcagcatt
gcattcagcttacctcagcgaaaatgggctggactttctattgggcaagaaatagaagtg
tctttatatacatttgacaaggccaaacaatgtattggcacaatgaccatcgagattgat
ttcctgcagaaaaaaagcatcgattccaacccttatgatactgacaagatggcagcagag
tttattcagcaattcaacaaccaggctttctcagtaggacagcagcttgtctttagcttc
aatgagaagctttttggcctgctggtaaaggatattgaagccatggatcctagcatccta
aagggagagcctgcgagtggtaaaaggcagaagattgaagtaggactggttgttggaaac
agtcaagttgcatttgaaaaagcagaaaattcatcactcaatcttattggcaaagctaaa
accaaggaaaatcgccagtctatcatcaatcctgactggaatttcgaaaaaatggggata
ggaggtctggacaaggaattttcagatatttttcgacgagcatttgcttcccgagtgttt
cctcctgagattgtggagcagatgggttgcaaacatgttaaaggcatcctgttatatggg
cccccaggttgtggtaagactctcttggctcgacagattggcaagatgttgaatgcaaga
gagcccaaagtggtcaatgggccagaaatccttaacaagtatgtgggagaatcagaagct
aacattcgtaaactctttgctgatgctgaagaggagcaaaggaggcttggtgctaacagc
ggcttgcacatcatcatcttcgatgaaatcgatgccatctgcaagcagagagggagcatg
gctggcagcacgggagtccatgacactgtcgtcaaccagttgctgtccaaaatcgacggc
gtagagcagctgaacaacattttagtcatcggaatgaccaacagaccagatctgatagat
gaggctctccttcgacctggaagactggaagttaaaatggaaataggcttaccagatgag
aaaggtcgactacagatccttcacatccatacggcaaggatgagaggccatcagttactc
tctgctgacgtagacattaaggaactggctgtagagactaagaatttcagcggtgctgag
ctggagggtctggtgcgagcagcacaatccactgccatgaacagacacataaaggccagt
actaaagttgaagtggacatggagaaagcagagagcctgcaggtgacaagaggggacttc
cttgcttctttggagaatgatatcaaaccagcatttggcacaaaccaagaggattatgcc
agttacattatgaatggtataatcaagtggggtgatccagttactcgagtcctagatgat
ggggagctgctggttcagcaaactaaaaacagtgaccgcacaccactggttagcgtcctt
ttggaaggccctcctcacagtgggaagactgctttagcggcaaagattgcagaggaatcc
aacttccccttcatcaagatctgttctcctgataagatgattggcttttctgagacagcc
aagtgtcaggccatgaagaagatctttgatgatgcatacaaatcccagctcagttgtgtg
gtcgtggatgacattgagaggctgcttgattatgtccctattggccctcgattttcgaat
ctggttttacaggctcttcttgtgttactgaaaaaggctcctcctcagggccgcaagctt
cttatcattgggaccacgagccgcaaagacgtccttcaggagatggaaatgctcaacgct
ttcagcaccaccatccacgtgcccaacattgccacaggagagcagctgttggaagctttg
gagcttttgggcaacttcaaggataaggaacgtaccacgattgcacagcaagtaaagggg
aagaaggtctggataggaatcaagaagctgctaatgttgatcgagatgtccctacagatg
gatcctgaataccgtgtgagaaaattcttggctctcttaagagaagaaggagctagcccc
ctcgactttgaaagtggactatttgcaaacacacagtga

DBGET integrated database retrieval system