KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508200
Entry
107508200         CDS       T06036                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: lysozyme C-like
  KO
K13915  lysozyme C [EC:3.2.1.17]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    107508200
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107508200
Enzymes [BR:ray01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     107508200
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107508200
SSDB
Motif
Pfam: Lys SLT_3 SLT
Other DBs
NCBI-GeneID: 107508200
NCBI-ProteinID: XP_015995369
LinkDB
Position
Unknown
AA seq 148 aa
MKTLLILGLLLLSVTVQGKVFERCELARTLKRLGMDGFRGVSLANWVCLAKWESSYNTRA
TNYNPGSQSTDYGIFQINSRYWCNDGKTPGAVNACRISCNALLQDDISQAVACAKRVVSD
PQGIRAWVAWRNRCQNQDLTQYIKGCGV
NT seq 447 nt   +upstreamnt  +downstreamnt
atgaagactctccttattctggggcttctcctcctttctgtaaccgtccagggcaaggtc
tttgaaaggtgcgagcttgccagaactctgaaaagacttggaatggacggcttcagggga
gtcagcctggcaaactgggtgtgtttggccaaatgggaaagtagttacaacacacgagct
accaactacaatcctggaagccaaagcactgattacggcatatttcagatcaatagccgc
tactggtgtaatgacggcaaaactccaggagcagttaatgcctgtcgtatatcatgcaac
gctttgctgcaagatgacatttctcaagccgtagcatgtgcaaagagggtggtcagtgat
ccacaaggcatcagagcatgggtggcatggagaaatcgttgtcaaaaccaagatctcact
cagtatatcaaaggttgcggagtgtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514505
Entry
107514505         CDS       T06036                                 

Gene name
LYZ
Definition
(RefSeq) lysozyme C
  KO
K13915  lysozyme C [EC:3.2.1.17]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    107514505 (LYZ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107514505 (LYZ)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     107514505 (LYZ)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107514505 (LYZ)
SSDB
Motif
Pfam: Lys SLT_3 SLT Transglycosylas Phage_lysozyme2
Other DBs
NCBI-GeneID: 107514505
NCBI-ProteinID: XP_016007773
LinkDB
Position
Unknown
AA seq 147 aa
MKTLLILGLLLLSVTVQGKVYERCELAKTLKRLGMDGFKGVSLATWVCVAKWESSYNTRA
THYNPNDKSTDYGILQINSHYWCNDGKTPGAVNTCNVSCKDLMHKDISKSVACAKKVVSE
QGIGAWVAWRNHCRNKDLAHYTHGCGV
NT seq 444 nt   +upstreamnt  +downstreamnt
atgaagactctccttattctggggcttctcctcctttctgtaactgtccagggcaaggtc
tatgaaaggtgcgagcttgccaaaactctgaaaagacttggaatggacggcttcaaagga
gtcagcttggcaacttgggtgtgtgtggccaaatgggaaagtagttacaacacacgagct
acccactacaatcctaacgacaaaagcactgattacggaatattgcagatcaatagccac
tactggtgtaatgacggcaaaactccaggagcagttaatacctgcaatgtatcctgcaaa
gatttgatgcacaaagacattagtaaatccgtagcatgtgcaaagaaggtggtcagtgaa
caaggcatcggagcatgggtggcatggagaaatcattgtcgaaacaaggatctcgctcat
tatacccatggttgtggagtgtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518983
Entry
107518983         CDS       T06036                                 

Definition
(RefSeq) lysozyme-like protein 1
  KO
K13915  lysozyme C [EC:3.2.1.17]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    107518983
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107518983
Enzymes [BR:ray01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     107518983
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107518983
SSDB
Motif
Pfam: Lys SLT_3 SLT
Other DBs
NCBI-GeneID: 107518983
NCBI-ProteinID: XP_016016644
LinkDB
Position
Unknown
AA seq 148 aa
MKAAGILALIGCLATVTEPKIYTRCKLAKIFSRAGLDNYRGFSLGNWICMAYYESHYNTT
AETVLKDGSIDYGIFQINSYTWCRNAKLQEKNHCHVACSALITDDLTDAIICAKKIVKET
EGMNYWQGWKKHCEGRDLSEWRKGCDVS
NT seq 447 nt   +upstreamnt  +downstreamnt
atgaaggccgcaggcatcttggccctgattggctgcctggccacagtcactgagcccaaa
atctacactcgctgtaaactggcaaaaatattttcgagggctggcctggacaactacagg
ggcttcagcctcggaaactggatctgcatggcatactatgagagccattacaacaccaca
gctgagactgtcctgaaggatggaagcattgactatggcatttttcaaataaacagttat
acgtggtgcagaaatgcaaagctacaagagaagaaccactgtcatgttgcctgctcagcc
ttgatcactgatgacctcacggatgcaattatctgtgccaagaaaattgttaaagagaca
gaagggatgaactactggcaaggctggaagaaacactgcgaaggcagagacctgtctgag
tggagaaaaggatgtgacgtctcatga

DBGET integrated database retrieval system