KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508214
Entry
107508214         CDS       T06036                                 

Gene name
AVPR1A
Definition
(RefSeq) vasopressin V1a receptor
  KO
K04226  arginine vasopressin receptor 1A
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04072  Phospholipase D signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107508214 (AVPR1A)
   04072 Phospholipase D signaling pathway
    107508214 (AVPR1A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107508214 (AVPR1A)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107508214 (AVPR1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107508214 (AVPR1A)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Peptide
   Vasopressin
    107508214 (AVPR1A)
SSDB
Motif
Pfam: 7tm_1 DUF1856 7TM_GPCR_Srv 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107508214
NCBI-ProteinID: XP_015995376
LinkDB
Position
Unknown
AA seq 420 aa
MDSMRFAGGSDAGPAGNSSPWWPLATGGTNASREIEALGEGGDAQRDERNEELAKLEIAV
LAVTFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRF
RGPDVLCRVVKHLQVFVMFVSAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIVGAWVL
SFLLSTPQYFVFSMVEVNNATKAYDCWATFIQPWGSRAYVTWMTGGIFVAPVVILGTCYG
FICYHIWRNIRGKTASRQGKGSERHGGAFHNGLLLAPCVSSVKTISRAKIRTVKMTFVIV
TAYIVCWAPFFIIQMWSVWDEGFAWVESENPAITITALLASLNSCCNPWIYMFFSGHLLQ
DCVQSFLCCQNMRETFNKEDSDSVSRRQTSYTNNRSPTNSMGWKDSPKSSKSIKFIPVSA
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggacagtatgcgtttcgccggaggctcagatgctgggcccgccggcaactccagcccg
tggtggcctctggccaccggcgggaccaacgccagccgggaaatcgaggcgctcggggaa
ggcggcgatgctcagagggacgagcgcaacgaggagctggccaagctagagatcgccgtg
ctggcggtgactttcgtggtggccgtgctgggtaacagtagtgtgttgctggcgctgcac
cgcacgcctcgcaagacgtcccgcatgcacctcttcatccgccacctcagcctggcggac
ctggccgtcgctttcttccaggtgcttccgcagctgtgctgggacatcacctaccgtttc
cggggacctgacgtgctgtgccgcgttgtgaaacacctgcaggtgttcgtcatgttcgtg
tcggcttatatgctggtggtcatgaccgccgaccgctacatcgctgtgtgccacccgctg
aagacgctgcagcagcccgcgcgccgctcgcgcctcatgatcgttggcgcctgggtgctg
agcttcctgctgagcacgccgcagtacttcgtcttctccatggtcgaggtgaacaacgcc
accaaggcctacgactgctgggccaccttcatccagccctggggttcccgtgcctacgtg
acctggatgaccggaggtatctttgtggctcccgtggtcatcctgggcacctgctacggc
ttcatctgctaccacatctggcgcaacatccgcggaaaaacggcgtcgcgccaggggaag
ggctctgagcgccatggtggtgccttccacaatgggctcctgctcgcgccctgtgtcagc
agcgtgaagaccatttcccgcgccaaaatccgcaccgtgaagatgactttcgtgattgtg
acagcttacattgtttgctgggcgcccttcttcatcattcagatgtggtctgtctgggat
gaggggttcgcctgggtcgagtcagaaaacccagccatcaccatcactgcattattggct
tccttgaatagttgctgcaacccctggatatacatgttttttagtggccatctcctccaa
gactgtgtccaaagcttcctgtgctgccaaaacatgagggaaacattcaacaaagaagat
tctgacagtgtgagcagaagacagacttcttacactaacaacagaagcccaacaaacagt
atggggtggaaggactctcctaaatcttccaagtccataaaatttattcctgtttcagcc
tga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508975
Entry
107508975         CDS       T06036                                 

Gene name
AVPR1B
Definition
(RefSeq) vasopressin V1b receptor
  KO
K04227  arginine vasopressin receptor 1B
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04072  Phospholipase D signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107508975 (AVPR1B)
   04072 Phospholipase D signaling pathway
    107508975 (AVPR1B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107508975 (AVPR1B)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107508975 (AVPR1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107508975 (AVPR1B)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Peptide
   Vasopressin
    107508975 (AVPR1B)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srv DUF1856 Srg Git3
Other DBs
NCBI-GeneID: 107508975
NCBI-ProteinID: XP_015996560
LinkDB
Position
Unknown
AA seq 422 aa
MESGPPWAANPVPGSTLSAPNATTPRPGRDQELAKVEIGVLATVLVLATGGNLTVLLALG
RRGRKLSRMHLFVLHLALTDLGVAVFQVLPQLLWDITYRFQGSDLLCRAIKYLQVLSMFA
STYMLLAMTLDRYLAVCHPLRSLQQPSQSTYPLIAAPWLVAAILSLPQVFIFSLREVTQG
SGELDCWADFHFPWGPRAYITWATLAIFVLPVAVLTACYSLICHEIWKNLKVKTKTCRVE
GGDWKIWGRPSPPAPAAATRELPSRVSSVSTISRAKIRTVKMSLVIVLAYVACWAPFFSV
QMWSVWDENAPDEDSTNVAFTISMLLGNLSSCCNPWIYMGFNSHLWPRPLRHLACCGSPR
PRMRRQLSNGSFSSRRTTLLTRSSVLPALSLRPNLSGRPGPEESLKESEHVYGEGVTETG
IF
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggaatctgggcctccttgggcagccaaccctgtccctgggagcaccctctctgccccc
aatgccaccacgcccaggcctggccgggatcaggagctggccaaggtggagatcggagtc
ttggccactgtcctggtgctggcgacagggggcaacctgacagtgctgctggcgctgggc
cggcggggccgcaagctctcccgcatgcacctgtttgtgctgcacctggccctgaccgac
ctgggcgtggcggtcttccaggtgctgccccagctgctgtgggacatcacctaccgcttc
cagggctccgacctcctctgccgggccatcaagtacctgcaggtgctcagcatgttcgcc
tccacctacatgctgctggccatgacactggaccgctacctggctgtgtgccaccctctg
cgcagcctccagcagcccagccagtctacttacccactcatcgccgctccctggctggtg
gctgccatcctcagcctcccgcaagtcttcattttttctttgcgggaggtgactcagggc
tcgggggaactggactgctgggcagactttcacttcccttgggggccacgggcctacatc
acctgggccaccctggccatcttcgtcctgcctgtggccgtgctcacagcctgctacagc
ctcatctgccacgagatctggaagaacctgaaagtcaagacgaagacctgcagggtagaa
ggaggggactggaagatttggggcaggccctcgcctcctgccccagcggcggccacgcga
gaactgccgtcccgggtcagcagtgtcagcaccatctcgagggccaagatccgaaccgtg
aagatgagccttgtcattgtgctggcctacgtcgcctgctgggcgcccttcttcagcgtc
cagatgtggtctgtgtgggacgagaatgcccctgatgaagattcaaccaatgttgctttc
accatctccatgcttttgggcaacctcagcagctgctgcaacccctggatctacatgggc
tttaacagccacctgtggccacgccccctgcgccatctggcttgctgcgggagtcccagg
ccccggatgcgcaggcagctctccaatggcagcttctccagccgtcgcaccacgctactg
acccgctccagcgtcctgcccgccctcagcctcaggcccaacctcagtgggaggcctggg
ccagaggagtcactgaaggagtcagagcacgtgtatggggaaggcgtcactgagacaggc
atcttttag

DBGET integrated database retrieval system