KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508222
Entry
107508222         CDS       T06036                                 

Gene name
TBK1
Definition
(RefSeq) serine/threonine-protein kinase TBK1 isoform X1
  KO
K05410  TANK-binding kinase 1 [EC:2.7.11.10]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04014  Ras signaling pathway
ray04137  Mitophagy - animal
ray04140  Autophagy - animal
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04623  Cytosolic DNA-sensing pathway
ray04657  IL-17 signaling pathway
ray05014  Amyotrophic lateral sclerosis
ray05022  Pathways of neurodegeneration - multiple diseases
ray05135  Yersinia infection
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107508222 (TBK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107508222 (TBK1)
   04137 Mitophagy - animal
    107508222 (TBK1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107508222 (TBK1)
   04621 NOD-like receptor signaling pathway
    107508222 (TBK1)
   04622 RIG-I-like receptor signaling pathway
    107508222 (TBK1)
   04623 Cytosolic DNA-sensing pathway
    107508222 (TBK1)
   04657 IL-17 signaling pathway
    107508222 (TBK1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107508222 (TBK1)
   05022 Pathways of neurodegeneration - multiple diseases
    107508222 (TBK1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107508222 (TBK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107508222 (TBK1)
   05161 Hepatitis B
    107508222 (TBK1)
   05160 Hepatitis C
    107508222 (TBK1)
   05171 Coronavirus disease - COVID-19
    107508222 (TBK1)
   05164 Influenza A
    107508222 (TBK1)
   05162 Measles
    107508222 (TBK1)
   05168 Herpes simplex virus 1 infection
    107508222 (TBK1)
   05163 Human cytomegalovirus infection
    107508222 (TBK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107508222 (TBK1)
   05169 Epstein-Barr virus infection
    107508222 (TBK1)
   05165 Human papillomavirus infection
    107508222 (TBK1)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     107508222 (TBK1)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   107508222 (TBK1)
Membrane trafficking [BR:ray04131]
 Autophagy
  Xenophagy
   Other xenophagy associated proteins
    107508222 (TBK1)
SSDB
Motif
Pfam: TBK1_CCD1 Pkinase TBK1_ULD PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like DUF713 CEP63 ubiquitin
Other DBs
NCBI-GeneID: 107508222
NCBI-ProteinID: XP_015995388
LinkDB
Position
Unknown
AA seq 729 aa
MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLK
KLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVV
GGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYL
HPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITG
KPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFA
ETSDILHRMIIHVFSLQQMTAHKIYIHSYNTATVFHELVYKQTKIISSNQELIYEGRRLV
LEPGRLAQHFPKTTEENPIFVVSQEPLNTIGLTYEKISLPKVHPRYDLDGDASMAKAITG
VVCYACRIASTLLLYQELMRKGIRWLIELVKDDHNETVHKKTEVVITLDFCIRNIEKTVK
VYEKLMKINLEAAELDEISDIHTKLLRLSSSQGTIETNLQDIESRLSPGGLLADTWAHQE
GTHPKDRHVEKLQVLLNYITEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTH
FTDECVKKYEAFLIKSEEWVRKMLHLRKQLLSLANQCLDIEEEVSKYQDYTNELQETLPQ
KMIAASSGIKHAMTPIYPCSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMD
GGLHNVDCL
NT seq 2190 nt   +upstreamnt  +downstreamnt
atgcagagcacttctaatcatctgtggcttttatctgatattttaggccaaggagctact
gcgaatgtctttcgtggaagacataagaaaactggtgacttatttgctatcaaagtattt
aataacataagcttccttcgcccagtagatgttcaaatgagagaattcgaagtgttaaaa
aaactcaatcacaaaaatattgtcaaattatttgctattgaagaggagacaacaacaaga
cataaagtccttattatggaattttgtccatgtgggagtttatacactgttttagaagag
ccatctaatgcctatggactaccagagtctgaatttttaattgttttgcgagatgtggtg
ggtggaatgaatcatctccgagagaacggcatagtgcatcgtgatatcaagccaggaaat
atcatgcgtgttataggggaagatggacagtctgtgtacaaactcacagattttggtgca
gctagagaattagaagatgatgagcagtttgtttctctgtatggcacagaagaatatttg
catcctgatatgtatgagagagcagtactaagaaaagatcaccagaagaaatacggagca
acagttgatctttggagcattggggtaacgttttaccatgcagctaccggatcactgccg
tttagaccatttgaagggccacgtaggaataaggaagtgatgtataaaataattactgga
aagccatctggtgcaatatctggagtacagaaagcagaaaatggaccaatcgactggagt
ggagacatgcctgtttcttgtagtctttctcggggtcttcaagttctacttactcctgtt
cttgcaaacatccttgaggcagatcaggaaaagtgttggggttttgaccagttttttgca
gaaactagtgatatacttcaccgaatgataattcatgttttttcgctgcaacaaatgaca
gctcacaagatttatattcatagttataatactgctactgtatttcatgaactggtgtat
aaacaaaccaaaattatttcttcaaatcaagaacttatatatgaaggacgacgcttagtt
cttgaacctggaagactggcacagcatttccctaaaactactgaggaaaaccctatcttt
gtagtaagccaggaacccctaaataccataggactgacatatgaaaaaatctcccttcct
aaagtacatccacgttatgatttagatggagatgctagcatggctaaggcaataacaggc
gttgtgtgttatgcctgtagaattgccagtaccctgctgctttatcaggaattaatgcga
aaggggatacgatggttgatagaattagttaaagatgatcataatgaaactgttcacaaa
aagacagaagttgtgatcacattggatttctgcatcagaaacattgaaaaaactgtgaaa
gtatatgaaaagttgatgaaaatcaacctagaagcagcagagttagatgaaatttcagac
atacacaccaaattgttgagactttccagttctcagggaacaatagaaaccaatcttcag
gatatcgaaagcagattatctccaggtggattgctggctgatacatgggcccatcaagaa
ggcactcatcccaaagataggcatgtggaaaagctacaggtcctgttaaattacatcaca
gagatttactatcagttcaaaaaagacaaagcagaacgtagactggcttataatgaagaa
cagatccacaaatttgataagcaaaaactctattaccatgcaacaaaagctatgacccac
tttacagatgaatgtgttaaaaagtatgaggcatttttgattaagtcagaagaatgggtg
agaaagatgcttcatcttaggaaacagttattatccctagctaatcagtgtttggatatt
gaagaagaagtatcaaagtatcaagactatactaatgagttacaagaaactttgcctcag
aaaatgattgcagcctccagtggaatcaaacatgccatgactccaatttatccatgttcc
aacacattagtagaaatgactcttggtatgaagaaattaaaggaagaaatggaaggggtt
gttaaagaacttgctgaaaataaccatattttagaaaggtttggctccttaaccatggat
ggtggccttcacaatgttgactgcctttag

DBGET integrated database retrieval system