KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508368Help
Entry
107508368         CDS       T06036                                 

Gene name
ADPRH
Definition
(RefSeq) ADP-ribosylarginine hydrolase
  KO
K01245  ADP-ribosylarginine hydrolase [EC:3.2.2.19]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Brite
KEGG Orthology (KO) [BR:ray00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107508368 (ADPRH)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.19  [protein ADP-ribosylarginine] hydrolase
     107508368 (ADPRH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADP_ribosyl_GH c-SKI_SMAD_bind
Motif
Other DBs
NCBI-GeneID: 107508368
NCBI-ProteinID: XP_015995625
LinkDB All DBs
Position
Unknown
AA seq 362 aa AA seqDB search
MCGGLMERYVAAMVLSAAGDALGYFNGKWEFLQNGEKIHQQLAQLGGLDAIYVEKWKVSD
DTVMHLATAEALVEAGEVLDLARLYSLFARHYQDCMGDMNGRAPGSTSVHNAMLLEPDKA
DGWRIPFNSHEGGCGAAMRAMCIGLRFPHLSQLDTLIQVSIESGRMTHHHPTGYLGALVS
ALFTSYAVNGKPPWQWGKGLMEVLPEAKKYIVQSGYFVEKNLQHWSYFQDQWEKYLKLRG
ILDGKSAPTFPNPYDVKERDQFYTSVSYSGWGGSSGHDAPMIAYDAILAAGDSWKELAHR
AFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKIEYRNRLEETARVLYSLGSKEDTVI
DV
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgggggattgatggagaggtatgtggctgccatggtgctgagtgcagctggagat
gccttggggtacttcaacgggaagtgggagttcctgcagaatggggagaagattcaccag
cagctggcccagcttggtggcttggatgccatatatgtggagaagtggaaagtcagcgat
gacacggtgatgcacctggccacggcagaagctcttgtggaagctggggaagtcttggac
ttggctcgactgtattccctctttgcaaggcattaccaagactgcatgggagacatgaat
ggccgggcaccaggtagtacgtcagtgcataacgccatgctgctggagccagacaaagcc
gatggctggaggattccctttaacagccatgagggcggctgtggggctgccatgcgggca
atgtgcattggtctcaggttccctcacctcagccagctggacacactgatccaggttagc
attgagagtggccgaatgactcaccaccaccccacaggctacctgggagcccttgtgtct
gctctttttacatcctatgctgtgaatggcaagcctccctggcaatggggaaaaggactg
atggaggtgttaccagaagccaaaaagtatattgtccagtcaggctactttgtggagaag
aatcttcaacactggtcctacttccaagaccaatgggaaaagtacctaaaacttagaggg
attttagatggcaaatcggcccctacctttcccaacccctatgatgtgaaggagagagat
cagttctacacctctgtgagctactctggctggggtggcagcagtggacatgatgccccc
atgattgcctacgatgccatcctggccgcaggagattcctggaaggagcttgcacaccga
gcatttttccatggtggagacagtgattctacagctgccattgctggctgctggtgggga
gttatgtatggttttaaaggagtgagtccctccaattatgagaaaatagaatacagaaac
cgcctggaagagacagctagggttttatattctcttgggtcaaaggaagatactgtaatt
gacgtttag

DBGET integrated database retrieval system