KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508553Help
Entry
107508553         CDS       T06036                                 

Definition
(RefSeq) allergen Fel d 4-like isoform X1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin RelB
Motif
Other DBs
NCBI-GeneID: 107508553
NCBI-ProteinID: XP_015995917
LinkDB All DBs
Position
Unknown
AA seq 204 aa AA seqDB search
MMKLLLLCLGLTLVCAHPAVVTKNFDYSKLSGEWYTILLSSNDKEAIQEDGVYRPFLEYA
NVLNNSTLALLFHLKVTGRCLPVYLLGKRTSENAVLNINFPGIDSLRIIEAVYDDYMIIH
FFNSSSKESLFNIGLFARTPDESPEVKEEFTRVVQKLGIPKSDILDLTKADRCLEAREKQ
AFPDSRLVIRDGEGWSWNDCLLVH
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagctgctgttgctgtgtctggggctcacactcgtgtgcgcgcatccggcagtt
gtgacaaagaacttcgattattcaaagttatcaggggagtggtataccattctcttgtcc
tcaaacgacaaagaagcgatccaagaagatggtgtctacaggccttttttggagtacgcc
aacgtcttaaataactctactctggcattactatttcatttaaaggtaactggaaggtgt
cttccagtttatttgttgggtaaaagaacatcagagaatgctgtacttaatataaacttc
cctggaattgatagtcttcgcataattgaagcggtctatgatgactatatgattatccat
ttcttcaattccagctccaaggaatcattatttaatatcggactctttgcccgaacacca
gatgagagtccagaagtcaaagaagaatttacgagagttgtccaaaaacttggaattcca
aagagcgacatactagacctaaccaaagcagatcgttgtctagaggcccgagagaagcaa
gcatttcctgactccaggttagtgatacgtgatggagaggggtggtcttggaatgactgc
cttctggtacattag

DBGET integrated database retrieval system