KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508566
Entry
107508566         CDS       T06036                                 

Definition
(RefSeq) securin-like
  KO
K06635  securin
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107508566
   04114 Oocyte meiosis
    107508566
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107508566
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107508566
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Securin
    107508566
SSDB
Motif
Pfam: Securin
Other DBs
NCBI-GeneID: 107508566
NCBI-ProteinID: XP_015995945
LinkDB
Position
Unknown
AA seq 186 aa
MTILIFADKESEEPGIHVAPKDQRKERPGSSGKVYDGRSQNSIPHVCKIFDAPPVLPKAT
RKTLGTVDRAAENSVKTNGPLKQKRANFSAKKVIEKTVKAKRSVPALDDTYLEIEKFFPF
SSLDFESFVLPEEHQITQFPLKGVPLMSLDEEQELEKLLHLGPPSPLKIPFHCGSPIRFS
LLQAFH
NT seq 561 nt   +upstreamnt  +downstreamnt
atgactattctgatctttgctgataaggaaagtgaagaaccaggcatccatgtggctcct
aaagaccaacggaaggagaggcctgggtcttcaggcaaagtttatgatgggagatctcag
aattcaataccacatgtttgcaaaatatttgatgctccaccagtcttacctaaagctact
agaaagactttgggaactgtcgacagagctgcagaaaactcagtaaagaccaatggacct
ctcaaacagaaacgggcaaacttctctgccaaaaaggtgatagagaagactgttaaagca
aaaaggtctgttcctgctttggatgacacctatctggaaatagaaaaattctttcccttc
agctctctagatttcgagagtttcgtcctgcctgaagagcaccagatcacacagttcccc
ttaaaaggggtgcctctcatgagcctcgatgaggagcaggaacttgaaaagctgttacac
ctgggacctccttcacctctgaagattcccttccactgcgggagtccaatccggttcagt
ctccttcaagcattccattga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521937
Entry
107521937         CDS       T06036                                 

Gene name
PTTG1
Definition
(RefSeq) securin
  KO
K06635  securin
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107521937 (PTTG1)
   04114 Oocyte meiosis
    107521937 (PTTG1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107521937 (PTTG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107521937 (PTTG1)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Securin
    107521937 (PTTG1)
SSDB
Motif
Pfam: Securin
Other DBs
NCBI-GeneID: 107521937
NCBI-ProteinID: XP_016022608
LinkDB
Position
Unknown
AA seq 205 aa
MATLIFVDKENGEPGTRVAPKDRLKQGSGSSVKALNGRTQDSTPHVGKMFGAPPALPKAS
RKALGTVNRATEKSVKSVKTNGPLKQKQSAFSAQKVTEKTDKAKTSVPASDDAYPEIEKF
FPFNPLDFESFDLPEEHQIAQLPLNGVPLMILEEERELEKLLHLGPPSPLKMPPPPWESN
PLPSPSSILSTLDVELPPVCYDLDV
NT seq 618 nt   +upstreamnt  +downstreamnt
atggctacactgatctttgttgataaggaaaatggagaaccagggacccgtgtggctcct
aaggatcggctgaagcaggggtctgggtcttcagtcaaagctctaaatgggaggactcag
gattcaacaccacatgttggcaaaatgtttggtgctccaccagccttacctaaagcttcc
agaaaggctttgggaactgtcaacagagctacagaaaagtcagtaaagtcagtaaagact
aatggacctctcaaacagaaacagagtgccttctctgcccaaaaggtgacagagaaaact
gataaagccaaaacctctgttcctgcttcggatgacgcctatccagaaatagaaaaattc
tttcccttcaatcctctagatttcgagagttttgacttgcccgaagagcaccagattgca
cagctccccttgaatggagtgcctctcatgatcctcgaagaggagagggaactcgaaaag
ctgttacacctgggccccccttctcctctgaagatgccccctccaccgtgggagtctaat
ccgttgccgtctccctcaagcattctgtcgactctggatgttgaattgccacctgtttgc
tatgacttagatgtttaa

DBGET integrated database retrieval system