KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508662
Entry
107508662         CDS       T06036                                 

Gene name
GABRR2
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit rho-2
  KO
K05190  gamma-aminobutyric acid receptor subunit rho
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04723  Retrograde endocannabinoid signaling
ray04727  GABAergic synapse
ray05032  Morphine addiction
ray05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107508662 (GABRR2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107508662 (GABRR2)
   04723 Retrograde endocannabinoid signaling
    107508662 (GABRR2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107508662 (GABRR2)
   05033 Nicotine addiction
    107508662 (GABRR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107508662 (GABRR2)
Ion channels [BR:ray04040]
 Ligand-gated channels
  GABA-A
   107508662 (GABRR2)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107508662
NCBI-ProteinID: XP_015996103
LinkDB
Position
Unknown
AA seq 490 aa
MVKPREIFPTAGYWKAASGSIDIHKMPYFTRLILFLFCLTVLVESRKPKRRRWTGQLEMP
KPSHLYKKNLDVTKIRKGKPQPLLRVEDHDFTMRPAFGGPAIPVGVDVQVESLDSISEVD
MDFTMTLYLRHYWKDERLAFPSASNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDN
IMLRVFPDGHVLYSMRITVTAMCNMDFSHFPLDSQTCSLELESYAYTDEDLMLYWKNGDE
SLKTDEKISLSQFLIQKFHTTSRLAFYSSTGWYNRLYINFTLRRHIFFFLLQTYFPATLM
VMLSWVSFWIDRRAVPARVSLGITTVLTMSTIITGVNASMPRVSYIKAVDIYLWVSFVFV
FLSVLEYAAVNYLTTVQERKERKLREKFPCMCGMLHSRTMMLDGSYSESEANSLAGYPRS
HTLTEEDQQDKIVVHLALSNESNTSRKKGLLKGQMGLRIFQNTHAIDKYSRLIFPASYIF
FNLIYWSVFS
NT seq 1473 nt   +upstreamnt  +downstreamnt
atggttaagcccagggagatttttcccactgctggttactggaaagcagcttctggcagc
atagacattcacaaaatgccttattttacaagactcattttgttcttgttttgcctgacg
gttcttgtggagagcagaaagcccaagaggaggagatggacagggcagctggaaatgcct
aagccaagtcacctatataagaagaaccttgatgtgaccaaaatccggaaaggaaagcct
cagcctcttctcagagtggaggatcacgatttcaccatgaggcctgcctttggaggccct
gccatcccagtgggcgtggacgtgcaggtggagagcctggacagcatctcggaagtggac
atggactttaccatgaccttgtacctgcggcattattggaaggacgagaggctagccttc
cccagtgccagcaacaagagcatgacctttgatggccgactggtaaagaagatctgggtc
cctgatgtcttctttgttcactccaaaaggtcattcacccatgacaccaccactgacaac
atcatgctaagggtgttcccggatgggcacgtgctgtacagcatgaggattacagtcacc
gccatgtgcaacatggacttcagccactttcccctggactcccagacctgttctttggag
ctggaaagctatgcatatacagacgaagatctgatgctgtattggaagaatggggacgaa
tccctgaaaacagatgaaaagatctccctgtctcagtttctgattcagaaatttcatacc
acttccagactggccttctacagcagcaccggctggtacaaccgtctgtacattaacttc
acgttgcgtcgccacatcttcttcttcttgctccaaacctatttccccgccaccctgatg
gtcatgttgtcctgggtgtccttctggatcgaccgcagagctgtgcctgccagagtttca
ctgggtatcaccacggtgctgaccatgtccaccatcatcacgggcgtgaacgcctccatg
ccccgcgtctcctacatcaaggccgtggacatctacctctgggtcagctttgtgttcgtg
ttcctctcggtgctggagtacgcggctgtcaactacctgacgacagtgcaggagcggaag
gaacggaagctccgggagaagttcccatgcatgtgtggaatgcttcactcaagaaccatg
atgctggatggaagctacagcgagtctgaggccaacagcctggccgggtacccgagaagc
catactctgacagaagaagaccagcaagacaaaatagtggttcacctggccctgagcaat
gaatccaacacctccaggaagaaagggcttctgaagggccagatgggtctgcgcatcttc
cagaacacccacgccattgacaaatactccaggttgatattccctgcctcctatatattt
ttcaacctaatttattggtcagtgttttcctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508665
Entry
107508665         CDS       T06036                                 

Gene name
GABRR1
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit rho-1
  KO
K05190  gamma-aminobutyric acid receptor subunit rho
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04723  Retrograde endocannabinoid signaling
ray04727  GABAergic synapse
ray05032  Morphine addiction
ray05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107508665 (GABRR1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107508665 (GABRR1)
   04723 Retrograde endocannabinoid signaling
    107508665 (GABRR1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107508665 (GABRR1)
   05033 Nicotine addiction
    107508665 (GABRR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107508665 (GABRR1)
Ion channels [BR:ray04040]
 Ligand-gated channels
  GABA-A
   107508665 (GABRR1)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107508665
NCBI-ProteinID: XP_015996104
LinkDB
Position
Unknown
AA seq 462 aa
MLAVQNMKIGIFLLWWGWVLATESRVHWRGREIHEMPKKGSPILKRSPDITKSPLTKSEQ
LLRIDDHDFSMRPGFGGPAIPVGVDVQVESLDSISEVDMDFTMTLYLRHYWKDERLSFPS
TNNLSMTFDGRLVKKIWVPDMFFVHSKRSFIHDTTTDNVMLRVQPDGKVLYSLRVTVTAM
CNMDFSRFPLDTQTCSLEIESYAYTEDDLMLYWKKGNDSLKTDERISLSQFLIQEFHTTT
KLAFYSSTGWYNRLYINFTLRRHIFFFLLQTYFPATLMVMLSWVSFWIDRRAVPARVPLG
ITTVLTMSTIITGVNASMPRVSYIKAVDIYLWVSFVFVFLSVLEYAAVNYLTTVQERKER
KRREKLPCTCGLPQPRAVMLDGSYGDVEVNDLGNYMPENGEKPDRMMVQLALASERSSPQ
RKSQRTSYVSMRIDTHAIDKYSRIIFPAAYILFNLIYWSIFS
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgttggctgtccagaatatgaaaattggcatcttccttttgtggtggggatgggttttg
gccactgaaagcagagtgcactggcgaggaagagaaatccacgagatgcctaagaaaggc
agcccaattctgaaacgaagcccagatatcaccaaatcaccactgacaaagtcagagcag
cttctgcggatagatgaccatgactttagcatgagacctggctttggaggcccggccatt
cctgttggtgtggatgtgcaggtggagagtctggacagtatctcagaggttgacatggac
tttacgatgaccctctacctgaggcactactggaaggatgagaggctgtccttcccgagc
accaacaacctcagcatgacgtttgacggccggctggtgaagaagatctgggtccccgac
atgttttttgtgcactccaagcgctccttcatccacgacaccaccacggacaacgtcatg
ctgcgcgtccagccggatgggaaagtgctctacagccttcgggttactgtgactgcaatg
tgcaacatggacttcagccggtttcctctggacacacaaacgtgctcacttgaaatcgaa
agctatgcctatacggaagatgacctcatgctatactggaaaaaaggcaacgactcctta
aagacagatgagcggatctcactctcccagttccttattcaagaattccatacgaccacg
aaactggccttctacagcagcacaggctggtacaaccgtctgtacattaacttcacgttg
cgtcgccacatcttcttcttcttgctccaaacctatttccccgccaccctgatggtcatg
ttgtcctgggtgtccttctggatcgaccgcagagctgtgcctgccagggtccccttaggt
atcaccacggtgctgaccatgtccaccatcatcacgggcgtgaacgcctccatgccccgt
gtctcctacatcaaggccgtggacatctacctctgggtcagctttgtgttcgtgttcctc
tcggtgctggagtacgcagctgtcaactacctgacgacagtgcaggagcggaaggaacgg
aagcgccgggagaagcttccctgcacctgtggcttgcctcagccacgcgccgtcatgctg
gatggcagctacggtgacgtggaggtgaatgacctgggcaactacatgccagagaatgga
gagaagccagacaggatgatggtgcagctggccctggcctcggaaaggagctccccccag
aggaaaagtcagaggaccagctacgtgagcatgaggatcgacacccacgccattgataaa
tattccaggatcatttttccagcagcatacattttattcaatttaatatactggtcgatc
ttctcatag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516604
Entry
107516604         CDS       T06036                                 

Gene name
GABRR3
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit rho-3
  KO
K05190  gamma-aminobutyric acid receptor subunit rho
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04723  Retrograde endocannabinoid signaling
ray04727  GABAergic synapse
ray05032  Morphine addiction
ray05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107516604 (GABRR3)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107516604 (GABRR3)
   04723 Retrograde endocannabinoid signaling
    107516604 (GABRR3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107516604 (GABRR3)
   05033 Nicotine addiction
    107516604 (GABRR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107516604 (GABRR3)
Ion channels [BR:ray04040]
 Ligand-gated channels
  GABA-A
   107516604 (GABRR3)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107516604
NCBI-ProteinID: XP_016011971
LinkDB
Position
Unknown
AA seq 468 aa
MILASQSVFFTCIWVTLMPNAFAAAEIEKLPQRCSSSGTRTCKQETRMRKDDNTKVWPLK
YEKLLHIEDHDFAMRPGFGKSPVPVGIDVQIESIDSISEVNMDFKMTFYLRHYWKDERLS
FPSTTNKSMTFDHRLIKKIWVPDVFFVHSKKSFIHDTTVENIMLRVHPDGNVLFSLRITV
SAMCFMDFSRFPLDTQNCSLELESYAYNEEDLMLYWKHGNKSLNTDEHISLSQFFIEEFS
ASSGFAFYSSTGWYNRLFINFVLRRHVFFFVLQTYFPAMLMVILSWVSFWIDRRAVPARV
SLGITTVLTMSTIISGMSASMPQVSYIKAVDVYLWVSSLFVFLSIIEYAAVNYLTTVEER
KQIRKTGKISGMYNIDVVQAMAFDGCYHDSETDLDQTSISLHSEEDSIQGRSTGSPSADS
PRIKRRKSLGGHTGRIILENNHVIDTYSRILFPIVYIIFNLVYWGIYV
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgatcctggcctcccagtccgtcttcttcacctgcatctgggtcactttgatgccaaat
gcttttgctgctgctgaaatcgagaagctcccgcagcggtgctcctcttccgggactcgg
acctgcaaacaagaaaccagaatgaggaaagatgacaataccaaagtgtggcccctaaaa
tatgagaaacttctccacatagaggaccacgattttgcaatgagacctggatttggaaag
tctccagtgccagtgggtatagatgtccagattgaaagtattgacagcatttcagaggtt
aacatggactttaagatgactttttatctcaggcattattggaaagatgaaagactctcc
tttcctagcacaacaaacaaaagcatgacctttgatcatagattgatcaaaaagatttgg
gtgcccgatgtcttttttgtccattctaaaaaatccttcatccatgatacgactgtggag
aatatcatgctgcgtgttcaccctgatggaaatgtcctcttcagtctcaggataaccgtt
tcagccatgtgctttatggatttcagcaggtttcctcttgacactcaaaattgttctctt
gaactggaaagctatgcctacaatgaagaggatctcatgctatactggaaacatggaaac
aagtccttgaatactgatgagcatatttccctttctcagttcttcattgaggagttcagt
gcatccagcggatttgccttctatagcagcacaggttggtataataggcttttcatcaac
tttgtgctaaggagacatgttttcttcttcgtgctgcaaacctatttcccggctatgtta
atggtgatattgtcatgggtttcattttggatcgaccgaagagctgttcctgcaagagtt
tccctgggaatcaccacggtgctgaccatgtccacgatcatctctggcatgagcgcctcc
atgccccaggtgtcctatatcaaggctgtggacgtgtacctttgggtcagctccctcttt
gtgttcctgtcaatcattgagtatgcagcagtgaactacctcaccacagtggaagaacgg
aaacaaatcaggaagacagggaagatttctggaatgtacaacattgatgtagttcaagct
atggcctttgatggttgttaccatgacagcgagactgacctggaccagacttctatttct
ctccactcagaagaggactccattcaaggaagatccacaggcagccccagtgcagattca
cctcggataaagagaaggaaatccctaggagggcacactggcagaatcattctggagaac
aaccatgtcatcgacacctattcaaggattttatttcccattgtgtacattatctttaat
ttggtttactggggtatatatgtgtga

DBGET integrated database retrieval system