KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508690
Entry
107508690         CDS       T06036                                 

Gene name
KITLG
Definition
(RefSeq) LOW QUALITY PROTEIN: kit ligand
  KO
K05461  KIT ligand
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04072  Phospholipase D signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04640  Hematopoietic cell lineage
ray04916  Melanogenesis
ray05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107508690 (KITLG)
   04014 Ras signaling pathway
    107508690 (KITLG)
   04015 Rap1 signaling pathway
    107508690 (KITLG)
   04072 Phospholipase D signaling pathway
    107508690 (KITLG)
   04151 PI3K-Akt signaling pathway
    107508690 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107508690 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    107508690 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107508690 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107508690 (KITLG)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107508690 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 107508690
NCBI-ProteinID: XP_015996118
LinkDB
Position
Unknown
AA seq 299 aa
MCSVVHLALDDASSASLSVIVNLNLRPLLLTWIITCIYLQLLLFNPLVKTTGICTNRITD
DVKDVTKLVANLPKDYKITLKYVPGMDILPSHCWINEMVEQLSVSLTDLLDKFSKISEGL
SNYSIIDKLGKIVDDLVECMEGHTFENIKKSPKSLESKLFTPEEFFRIFNRSIDAFKDLE
MVSSKTSECVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKTSNSIGDSSVQ
WAAMVLPAFFSLLIGFGFGALYWKKKQSNPTRTVENIQINEEDNEISMLQEKESEFQEV
NT seq 900 nt   +upstreamnt  +downstreamnt
atgtgctcagtggtacacttggcgctggatgacgcctccagtgcctccttgagtgtgatt
gtcaacttgaacctaagaccactactgctaacttggattatcacttgcatttatcttcaa
ctgctcttatttaatcccctcgtcaaaactacagggatctgcacgaaccgcatcactgat
gatgtgaaagacgttacaaaattggtggcaaatcttccgaaagactataagataaccctc
aaatatgtccccggaatggacattttgcctagtcattgttggataaatgaaatggtggaa
caattgtcagtcagcttgactgatcttctggacaagttttcaaaaatttctgaaggctta
agtaattattctatcatagacaaacttgggaaaatagtggatgacctcgtggagtgcatg
gaaggacacacattcgagaatataaaaaaatcacctaagagcctagaatccaagctgttt
actcctgaagaattctttagaatttttaatagatccatcgatgccttcaaggacttggag
atggtgtcatctaaaactagtgaatgtgtggtttcttcaacattaagtcctgaaaaagat
tccagagtcagtgtcacaaaaccatttatgttaccccctgttgcagccagctcccttagg
aatgacagcagtagcagtaataggaaaacctcaaattccattggagactccagtgtacag
tgggcagcaatggtcttgccagcattcttttctcttctaattgggtttggttttggagcc
ttatactggaagaagaaacaatcaaatcctacaaggacagttgaaaatatacagattaat
gaagaggataatgagataagtatgttgcaagaaaaagagagtgagtttcaagaagtgtaa

DBGET integrated database retrieval system