KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508841
Entry
107508841         CDS       T06036                                 

Gene name
AQP8
Definition
(RefSeq) aquaporin-8
  KO
K09869  aquaporin-8
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    107508841 (AQP8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107508841 (AQP8)
Transporters [BR:ray02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    107508841 (AQP8)
SSDB
Motif
Pfam: MIP
Other DBs
NCBI-GeneID: 107508841
NCBI-ProteinID: XP_015996348
LinkDB
Position
Unknown
AA seq 263 aa
MSGPEAVLACEPEFSHGEGRQRGAGARGRGLWYERRLQPCVVELLGSALFVFIGCLSVIE
HWPDTGPLQPALAHGLALGLIIATLGNISGGHFNPAVSLAAALIGGLDLTMLLPYWASQL
CGGLVGAALAKAVSSEERFWNASGAAFVTVQEPGQLTGAVLTEILLTMLLTLAVCMGAIN
EKTQGPLAPFSIGFSVTVGILAGSAVSGACMNPARAFGPAVVASRWDFHWVYWLGPLSGS
LLMGALVRFFIGDKKTRLILRGR
NT seq 792 nt   +upstreamnt  +downstreamnt
atgtccggaccggaggctgtgttggcgtgcgagccggagttcagccacggcgagggccgg
cagcggggcgcgggcgcccggggccgcgggctctggtacgagcgccgcctgcagccctgc
gtggtggagctgctgggcagcgccctcttcgtcttcatcgggtgcctgtcggtcatcgag
cactggccggacaccgggccactgcagcccgccctggcccacgggctggccctggggctc
atcattgccacgctggggaacatcagcggcggacacttcaaccccgcggtgtccctggca
gccgcgctcatcgggggcctcgacctgacgatgctgcttccctactgggcctcccagctg
tgtggcgggctcgtcggggccgcgctggccaaggcggtgagttctgaggagaggttctgg
aatgcatcaggggcagcctttgtgacagtccaggagccggggcagctgacaggcgcagtg
ctgacagagatcctgctgaccatgctgctgaccctggctgtctgcatgggcgccatcaac
gagaagacgcagggccctctggctccattctccatcggattctctgtcaccgtgggcatc
ctggcagggagtgccgtgtctggagcctgcatgaaccccgcccgcgcctttggacctgct
gtggtggccagccgctgggacttccactgggtctactggctggggccgctctcgggcagc
ctgctcatgggcgcactcgtcagattcttcattggagataagaaaacccgcctgatccta
aggggacggtga

DBGET integrated database retrieval system