KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508908
Entry
107508908         CDS       T06036                                 

Gene name
CHAT
Definition
(RefSeq) choline O-acetyltransferase
  KO
K00623  choline O-acetyltransferase [EC:2.3.1.6]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00564  Glycerophospholipid metabolism
ray04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107508908 (CHAT)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107508908 (CHAT)
Enzymes [BR:ray01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.6  choline O-acetyltransferase
     107508908 (CHAT)
SSDB
Motif
Pfam: Carn_acyltransf
Other DBs
NCBI-GeneID: 107508908
NCBI-ProteinID: XP_015996417
LinkDB
Position
Unknown
AA seq 641 aa
MPILEKDPHKMAAKTPSSEEETGLPKLPVPPLQQTLATYLRCMQHLVPKEQFKRSQAIVQ
RFGAPGGLGETLQQKLLEQQEKTANWVSEYWLNDMYLNNRLALPVNSSPAVIFARQHFQD
TNDQLRFAANLISSILNYKALLDSHSIPTDCAKGQLSGQQLCMKQYYGLFSSYRLPGHTQ
DTLVAQKSSVMPEPEHIIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERL
PPIGLLTSDGRSEWAEARTVLMKDSTNRDSLDMIERCICLVCLDAPGGLELSDTNRALQL
LHGGGCSRNGANRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHMMKSSKK
LVRADSVSELPAPRRLRWKCSPEIQGLLASSAEKLQRIVKNLDFTVYKFDNYGKTFIKKQ
KFSPDAFIQVALQLAFYRLHRRLVPTYESASIRRFQEGRVDNIRSATPEALSFVKAITDH
KADMPDSEKFLLLKDAIRAQTEYTVMAVTGMAIDNHLLGLRELARNMCKELPEMFTDETY
LMSNQFVLSTSQVPTTMDMFCCYGPVVPNGYGTCYNPQPESILFCISSFHGCKETSSTKF
AKAVEESLTEMRDLCSLPQSPIGEPLSTKGKAKRPSQGHQP
NT seq 1926 nt   +upstreamnt  +downstreamnt
atgcccatcctggaaaaagatccccataagatggcagcaaaaactcccagcagtgaggag
gaaactgggctgcccaaactcccagtgcccccacttcagcagaccttggccacttacctg
cggtgcatgcagcacctggtccccaaggagcagttcaagaggagccaagccattgtgcag
cgatttggggcacctggtggccttggagagaccctgcagcagaagctgctggagcagcag
gagaagacagcaaactgggtgtctgagtactggctgaatgatatgtatcttaataaccgc
ttggccctgcctgtcaactccagcccagctgtgatctttgcccggcagcacttccaggac
accaatgatcagctaaggtttgctgccaatctcatctccagtatactcaactacaaggcc
ctgctggacagccattccatccccactgactgtgccaaaggacagctgtcagggcagcag
ctctgtatgaagcaatactatgggctcttctcctcctaccggctccctggccacacacag
gacacactggtggcccagaagagcagtgtcatgcccgagccggagcacatcatcgtggcc
tgctgcaaccagttctttgtcttggatgttgtcattaatttccgccgtctcagtgagggg
gatctattcactcagttgagaaagatagtcaaaatggcttccaacgaggatgaacgtttg
cctccaatcggcctgctgacatcagatggaaggagcgagtgggctgaggccaggacagtc
ctcatgaaagactctaccaaccgggactcactggacatgattgagcgctgcatctgccta
gtttgcctggatgccccagggggcttggagctcagtgacaccaacagggcactccagctc
cttcatggtggaggctgcagcaggaatggggcaaaccgctggtatgacaagtccctgcag
tttgtggtgggccgggatggcacctgcggcgtggtgtgtgaacactctccattcgacggc
atcgtcctggtgcagtgcacggaacacctgctcaagcatatgatgaagagcagcaagaaa
ctggtccgagctgactctgtcagtgagctgccagcccccagaagactgaggtggaaatgc
tccccagaaattcaaggccttttagcctcctctgcagaaaaacttcagcgaatagtaaag
aatctggacttcactgtttataagtttgacaactatggaaaaacattcattaagaagcag
aaattcagccctgatgcttttattcaggtggccctccaactggccttctacaggctccac
aggagactcgtgcccacctatgagagtgcgtccattcgccgattccaagagggacgggtg
gataatattcgatcagccactccagaggcactgagttttgtgaaagccatcactgaccac
aaggctgacatgccggattcggagaagtttctgctcctgaaggatgccatccgagcccaa
actgagtacacggtcatggccgtaacagggatggctattgacaaccacctgctagggctg
cgggagctggcccggaacatgtgcaaggagctgcctgaaatgttcacggatgaaacatac
ttgatgagcaatcaatttgtcctctccaccagccaggtacccacaaccatggacatgttt
tgctgttatggacctgtggtgcccaatgggtatggcacctgctacaacccccagcccgaa
agcatcctcttctgcatctccagcttccacggctgcaaggagacctcttctaccaagttt
gcgaaagctgtggaagaaagcctcactgaaatgagagacctctgcagtctgccacagtct
cccattggtgagccactgtcaacaaaaggaaaagcaaaaagacccagccagggccaccaa
ccctga

DBGET integrated database retrieval system