KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508930
Entry
107508930         CDS       T06036                                 

Gene name
MAP2K5
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 5 isoform X1
  KO
K04463  mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04540  Gap junction
ray04722  Neurotrophin signaling pathway
ray04921  Oxytocin signaling pathway
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107508930 (MAP2K5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107508930 (MAP2K5)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107508930 (MAP2K5)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107508930 (MAP2K5)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107508930 (MAP2K5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107508930 (MAP2K5)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     107508930 (MAP2K5)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: STE group
  STE7 family
   107508930 (MAP2K5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 Pkinase_fungal Kinase-like Seadorna_VP7
Other DBs
NCBI-GeneID: 107508930
NCBI-ProteinID: XP_015996466
LinkDB
Position
Unknown
AA seq 448 aa
MLWLAIGPFYAMESQVLVIRIKIPNSGAVDWTVHSVPQLLFRDVLDVIGQVLPEATTTAF
EYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL
KVNTRAGPSQHSSPAVSDSLPSSSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTV
YKAYHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISIC
TEFMDGGSLDVYRKIPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLC
DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQ
KNQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIM
QFNDGNAAVVSMWVCRALEERRSQKGPP
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgctgtggctggccattggccccttctatgccatggagagccaggtgctggtgattcgc
atcaagattccaaatagtggcgcggtggactggacagtgcactccgtgccgcagttactc
ttcagggatgtgctggatgtgataggccaggttctgcctgaagcaacaaccacagcattt
gaatatgaagatgaagatggtgatcgaattacagtgaggagtgatgaagaaatgaaggca
atgctgtcatattattattccacagtaatggaacagcaagtaaatggacagttaatagag
cctctgcagatatttccaagagcctgcaagcctcctggggaacggaacatacatggcctg
aaggtgaatacccgggccggaccctctcaacacagcagcccagcagtctcggattcactt
ccaagcagtagcttaaagaagtcttctgctgaactgaaaaaaatattagccaatggccag
atgaatgaacaagacatacggtatcgagacactcttggtcatggcaacggaggtacagtc
tacaaagcatatcatgtcccaagtgggaaaatactagctgtaaaggtcatactactagat
attacactggaacttcagaagcaaattatgtctgaattagagattctttataagtgtgat
tcatcatatatcatagggttttatggtgcatttttcgtagaaaacaggatttcaatatgt
acagaattcatggatggggggtctttggatgtatatagaaaaattccagagcatgtcctt
ggaaggattgcagtagcagttgttaaaggccttacctatttgtggagtttaaagatttta
catagagatgtgaagccctccaatatgctggtaaacacaagaggacaagtcaagctatgt
gattttggagttagcactcagctggtgaattctatagccaagacgtatgttggaacaaat
gcttatatggcgcctgaaagaatttcaggagagcagtatggaatccactctgatgtctgg
agcttaggaatctctttcatggagcttgctcttgggaggtttccatatcctcagattcag
aaaaaccagggatctttaatgcctctccagcttctgcagtgcattgttgatgaggattcg
cccgtccttccggttggagagttctccgagccatttgtacatttcatcactcagtgcatg
cgaaaacagccaaaagaaaggccagcacctgaggaattaatgggccacccgttcatcatg
cagttcaacgatggaaacgctgccgtggtgtccatgtgggtgtgcagggcgctggaggag
aggcggagccagaagggccccccctga

DBGET integrated database retrieval system