KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508935
Entry
107508935         CDS       T06036                                 

Gene name
SMAD3
Definition
(RefSeq) mothers against decapentaplegic homolog 3
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04068  FoxO signaling pathway
ray04110  Cell cycle
ray04144  Endocytosis
ray04218  Cellular senescence
ray04310  Wnt signaling pathway
ray04350  TGF-beta signaling pathway
ray04371  Apelin signaling pathway
ray04390  Hippo signaling pathway
ray04520  Adherens junction
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04659  Th17 cell differentiation
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05161  Hepatitis B
ray05166  Human T-cell leukemia virus 1 infection
ray05200  Pathways in cancer
ray05210  Colorectal cancer
ray05212  Pancreatic cancer
ray05220  Chronic myeloid leukemia
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107508935 (SMAD3)
   04350 TGF-beta signaling pathway
    107508935 (SMAD3)
   04390 Hippo signaling pathway
    107508935 (SMAD3)
   04371 Apelin signaling pathway
    107508935 (SMAD3)
   04068 FoxO signaling pathway
    107508935 (SMAD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107508935 (SMAD3)
  09143 Cell growth and death
   04110 Cell cycle
    107508935 (SMAD3)
   04218 Cellular senescence
    107508935 (SMAD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107508935 (SMAD3)
   04550 Signaling pathways regulating pluripotency of stem cells
    107508935 (SMAD3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    107508935 (SMAD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107508935 (SMAD3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107508935 (SMAD3)
   05212 Pancreatic cancer
    107508935 (SMAD3)
   05225 Hepatocellular carcinoma
    107508935 (SMAD3)
   05226 Gastric cancer
    107508935 (SMAD3)
   05220 Chronic myeloid leukemia
    107508935 (SMAD3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    107508935 (SMAD3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107508935 (SMAD3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107508935 (SMAD3)
   05161 Hepatitis B
    107508935 (SMAD3)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 107508935
NCBI-ProteinID: XP_015996478
LinkDB
Position
Unknown
AA seq 425 aa
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHSNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtcgtccatcctgccctttactcctccgatcgtgaagcgcctcctgggctggaagaag
ggcgagcagaacgggcaggaggagaagtggtgcgagaaggcggtcaagagtttggtcaag
aagctcaagaagacggggcagctggatgagctggagaaggccatcaccacgcagaatgtc
aacaccaagtgcatcactatcccaaggtccctggatggccgactgcaggtgtcccatagg
aaggggctcccccatgtcatctactgccgcttgtggcggtggcctgacctgcacagccac
cacgagctgcgggccatggagctgtgcgagtttgccttcaacatgaagaaggacgaggtc
tgcgtgaatccctaccactatcagagggtagagaccccagttctacctcctgtgttggtg
ccgcgccacacggagatcccggccgagttccccccactggacgactacagccattccatc
cccgagaacactaacttccctgcgggcattgagccgcagagcaatattccagaaacccca
ccccctggctacctgagtgaagatggagagaccagtgaccaccagatgaaccacagcatg
gacgcaggttctccaaacctatccccgaatccgatgtccccagcacacagtaacttagac
ctgcagcccgtcacctactgcgagccagccttctggtgctccatctcctactacgagctg
aaccagcgcgttggggagacattccacgcctcgcagccctccatgacggtggatggcttc
accgacccctccaactcggagcgcttctgcctggggctgctctccaatgtcaacaggaat
gcggctgtggaactcacgcggaggcatatcgggcgaggcgtgcggctgtactacatcgga
ggggaggtcttcgcagagtgcctcagcgacagcgctatcttcgtgcagtcccccaactgt
aaccagcgctatggttggcacccggccaccgtctgcaagatcccacctggatgcaacctg
aagatcttcaacaaccaggagttcgctgccctcctggctcagtctgtcaaccaaggtttc
gaggccgtctaccagctgacgcgcatgtgcaccatccgcatgagcttcgtcaagggctgg
ggcgcagagtacaggagacagacagtgaccagcaccccctgctggatcgagctgcacctg
aacgggcctttgcaatggcttgacaaggtcctcacccagatgggctccccaagcatccgc
tgttccagtgtgtcctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107512663
Entry
107512663         CDS       T06036                                 

Gene name
SMAD2
Definition
(RefSeq) mothers against decapentaplegic homolog 2 isoform X1
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04144  Endocytosis
ray04218  Cellular senescence
ray04350  TGF-beta signaling pathway
ray04371  Apelin signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04659  Th17 cell differentiation
ray04926  Relaxin signaling pathway
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05142  Chagas disease
ray05166  Human T-cell leukemia virus 1 infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05210  Colorectal cancer
ray05212  Pancreatic cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107512663 (SMAD2)
   04390 Hippo signaling pathway
    107512663 (SMAD2)
   04371 Apelin signaling pathway
    107512663 (SMAD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107512663 (SMAD2)
  09143 Cell growth and death
   04110 Cell cycle
    107512663 (SMAD2)
   04218 Cellular senescence
    107512663 (SMAD2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107512663 (SMAD2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    107512663 (SMAD2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107512663 (SMAD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107512663 (SMAD2)
   05205 Proteoglycans in cancer
    107512663 (SMAD2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107512663 (SMAD2)
   05212 Pancreatic cancer
    107512663 (SMAD2)
   05225 Hepatocellular carcinoma
    107512663 (SMAD2)
   05226 Gastric cancer
    107512663 (SMAD2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    107512663 (SMAD2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107512663 (SMAD2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107512663 (SMAD2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107512663 (SMAD2)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 107512663
NCBI-ProteinID: XP_016003921
LinkDB
Position
Unknown
AA seq 467 aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcgtccatcttgccattcactccaccggttgtgaagagactgctgggatggaagaaa
tcagctggtggatctggaggagcaggtggaggagagcagaatggacaggaagaaaaatgg
tgtgagaaggcagttaaaagtttggtgaagaagctaaagaaaacaggacgattagatgag
cttgagaaagccatcaccactcaaaattgtaatactaagtgtgtcaccataccaagcact
tgctctgaaatttggggactgagtacaccaaatacgatagatcagtgggatacaacaggc
ctttacagcttctctgaacaaaccaggtctcttgatggtcgacttcaggtatctcatcga
aaaggattgccacatgttatatattgccgattatggcgctggcctgatcttcacagtcat
catgaactcaaagcaattgaaaactgcgaatatgcttttaatcttaaaaaggatgaagta
tgtgtaaacccttaccactaccagagagttgagacaccagttttgcctcctgtgttagtg
ccacggcacactgagatcttaacagaactaccacctctggatgattatacccactccatt
ccagaaaacactaatttcccagcgggaattgagccacagagtaattacatcccagaaacg
ccacctcctggatatatcagtgaagatggagaaacaagtgatcaacagttaaaccaaagt
atggatacaggatctccagcagaactatctcctactactctttcccctgttaatcatagt
ttggatttgcagccagttacttattcagaacctgcattttggtgttcaatagcatattat
gaattaaaccagagggttggagagaccttccatgcatcacagccctcactcactgtagac
ggcttcacagatccatcaaattcagagagattctgcttaggtttactctccaacgtcaac
cgaaatgctacagtagaaatgacaagaagacatataggaagaggcgtgcgcttatattac
ataggtggggaagtttttgctgagtgcctaagtgatagtgcaatctttgtgcagagcccc
aattgtaatcagagatacggctggcaccctgcaacagtgtgtaaaattccaccaggctgt
aatctgaagatcttcaacaaccaggaatttgctgctcttctggctcagtctgttaatcag
ggttttgaagccgtgtatcagctaactagaatgtgcaccataagaatgagttttgtgaaa
ggttggggagcagaataccgaaggcagacggtaacaagcactccttgctggattgaactt
catctgaatggacctctacagtggttggacaaagtattaactcagatgggatccccttca
gtgcgttgctcaagcatgtcataa

DBGET integrated database retrieval system