KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508942
Entry
107508942         CDS       T06036                                 

Gene name
MAP2K1
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1 isoform X1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04066  HIF-1 signaling pathway
ray04068  FoxO signaling pathway
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04114  Oocyte meiosis
ray04140  Autophagy - animal
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04210  Apoptosis
ray04218  Cellular senescence
ray04270  Vascular smooth muscle contraction
ray04370  VEGF signaling pathway
ray04371  Apelin signaling pathway
ray04380  Osteoclast differentiation
ray04510  Focal adhesion
ray04540  Gap junction
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04613  Neutrophil extracellular trap formation
ray04620  Toll-like receptor signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04668  TNF signaling pathway
ray04720  Long-term potentiation
ray04722  Neurotrophin signaling pathway
ray04725  Cholinergic synapse
ray04726  Serotonergic synapse
ray04730  Long-term depression
ray04810  Regulation of actin cytoskeleton
ray04910  Insulin signaling pathway
ray04912  GnRH signaling pathway
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04917  Prolactin signaling pathway
ray04919  Thyroid hormone signaling pathway
ray04921  Oxytocin signaling pathway
ray04926  Relaxin signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray04929  GnRH secretion
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05034  Alcoholism
ray05132  Salmonella infection
ray05135  Yersinia infection
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05210  Colorectal cancer
ray05211  Renal cell carcinoma
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05216  Thyroid cancer
ray05218  Melanoma
ray05219  Bladder cancer
ray05220  Chronic myeloid leukemia
ray05221  Acute myeloid leukemia
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05230  Central carbon metabolism in cancer
ray05231  Choline metabolism in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107508942 (MAP2K1)
   04012 ErbB signaling pathway
    107508942 (MAP2K1)
   04014 Ras signaling pathway
    107508942 (MAP2K1)
   04015 Rap1 signaling pathway
    107508942 (MAP2K1)
   04370 VEGF signaling pathway
    107508942 (MAP2K1)
   04371 Apelin signaling pathway
    107508942 (MAP2K1)
   04668 TNF signaling pathway
    107508942 (MAP2K1)
   04066 HIF-1 signaling pathway
    107508942 (MAP2K1)
   04068 FoxO signaling pathway
    107508942 (MAP2K1)
   04072 Phospholipase D signaling pathway
    107508942 (MAP2K1)
   04071 Sphingolipid signaling pathway
    107508942 (MAP2K1)
   04024 cAMP signaling pathway
    107508942 (MAP2K1)
   04022 cGMP-PKG signaling pathway
    107508942 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    107508942 (MAP2K1)
   04150 mTOR signaling pathway
    107508942 (MAP2K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107508942 (MAP2K1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    107508942 (MAP2K1)
   04210 Apoptosis
    107508942 (MAP2K1)
   04218 Cellular senescence
    107508942 (MAP2K1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107508942 (MAP2K1)
   04540 Gap junction
    107508942 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    107508942 (MAP2K1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107508942 (MAP2K1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107508942 (MAP2K1)
   04620 Toll-like receptor signaling pathway
    107508942 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    107508942 (MAP2K1)
   04660 T cell receptor signaling pathway
    107508942 (MAP2K1)
   04662 B cell receptor signaling pathway
    107508942 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    107508942 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    107508942 (MAP2K1)
   04062 Chemokine signaling pathway
    107508942 (MAP2K1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107508942 (MAP2K1)
   04929 GnRH secretion
    107508942 (MAP2K1)
   04912 GnRH signaling pathway
    107508942 (MAP2K1)
   04915 Estrogen signaling pathway
    107508942 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    107508942 (MAP2K1)
   04917 Prolactin signaling pathway
    107508942 (MAP2K1)
   04921 Oxytocin signaling pathway
    107508942 (MAP2K1)
   04926 Relaxin signaling pathway
    107508942 (MAP2K1)
   04935 Growth hormone synthesis, secretion and action
    107508942 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    107508942 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    107508942 (MAP2K1)
   04916 Melanogenesis
    107508942 (MAP2K1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107508942 (MAP2K1)
  09156 Nervous system
   04725 Cholinergic synapse
    107508942 (MAP2K1)
   04726 Serotonergic synapse
    107508942 (MAP2K1)
   04720 Long-term potentiation
    107508942 (MAP2K1)
   04730 Long-term depression
    107508942 (MAP2K1)
   04722 Neurotrophin signaling pathway
    107508942 (MAP2K1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107508942 (MAP2K1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107508942 (MAP2K1)
   05206 MicroRNAs in cancer
    107508942 (MAP2K1)
   05205 Proteoglycans in cancer
    107508942 (MAP2K1)
   05230 Central carbon metabolism in cancer
    107508942 (MAP2K1)
   05231 Choline metabolism in cancer
    107508942 (MAP2K1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107508942 (MAP2K1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107508942 (MAP2K1)
   05212 Pancreatic cancer
    107508942 (MAP2K1)
   05225 Hepatocellular carcinoma
    107508942 (MAP2K1)
   05226 Gastric cancer
    107508942 (MAP2K1)
   05214 Glioma
    107508942 (MAP2K1)
   05216 Thyroid cancer
    107508942 (MAP2K1)
   05221 Acute myeloid leukemia
    107508942 (MAP2K1)
   05220 Chronic myeloid leukemia
    107508942 (MAP2K1)
   05218 Melanoma
    107508942 (MAP2K1)
   05211 Renal cell carcinoma
    107508942 (MAP2K1)
   05219 Bladder cancer
    107508942 (MAP2K1)
   05215 Prostate cancer
    107508942 (MAP2K1)
   05213 Endometrial cancer
    107508942 (MAP2K1)
   05224 Breast cancer
    107508942 (MAP2K1)
   05223 Non-small cell lung cancer
    107508942 (MAP2K1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107508942 (MAP2K1)
   05022 Pathways of neurodegeneration - multiple diseases
    107508942 (MAP2K1)
  09165 Substance dependence
   05034 Alcoholism
    107508942 (MAP2K1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107508942 (MAP2K1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107508942 (MAP2K1)
   05135 Yersinia infection
    107508942 (MAP2K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107508942 (MAP2K1)
   05170 Human immunodeficiency virus 1 infection
    107508942 (MAP2K1)
   05161 Hepatitis B
    107508942 (MAP2K1)
   05160 Hepatitis C
    107508942 (MAP2K1)
   05164 Influenza A
    107508942 (MAP2K1)
   05163 Human cytomegalovirus infection
    107508942 (MAP2K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107508942 (MAP2K1)
   05165 Human papillomavirus infection
    107508942 (MAP2K1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107508942 (MAP2K1)
   01522 Endocrine resistance
    107508942 (MAP2K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107508942 (MAP2K1)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     107508942 (MAP2K1)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: STE group
  STE7 family
   107508942 (MAP2K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7 NAD_binding_6
Other DBs
NCBI-GeneID: 107508942
NCBI-ProteinID: XP_015996490
LinkDB
Position
Unknown
AA seq 393 aa
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCHVEGDAAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAF
IKRSDAEEVDFAGWLCSTIGLNQPSTPTHAAGV
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcccaagaagaagccgacgcccatccagctgaatccagccccagatggctccgcggtt
aacgggaccagctcggcggagaccaacctggaggccttgcaaaagaagctggaggagctg
gagctggatgagcagcagcggaagcgccttgaggcctttcttacccagaagcagaaggtg
ggggaactgaaggatgatgactttgagaagatcagtgaactgggtgctggcaatggcggt
gtggtgttcaaggtctctcacaagccatccggcctggtcatggccagaaagttaattcac
ctggaaatcaaacctgcaatccggaaccagatcataagggagctgcaggttctacatgag
tgtaactctccgtacatcgtgggcttctatggtgcattttacagtgatggcgagatcagc
atctgcatggagcatatggatgggggttccttggatcaagtgctgaagaaagctggaaga
attcctgaacaaattttaggaaaagttagcattgctgtgataaaaggtctgacatatctg
agagagaagcacaagattatgcatagagatgtcaagccttctaacatcctagtgaactct
cgtggggagatcaagctctgtgactttggggtcagtgggcagctcatcgactccatggcc
aactccttcgtgggcacaaggtcctacatgtcgccagaaagactccaggggactcactac
tcggtgcagtcggacatttggagtatggggctctctctggttgagatggcagttgggagg
tatcccatccctcctccagatgccaaggagctagaactgatgtttgggtgccacgtggaa
ggagatgcagctgagacaccgcctaggccaaggacccctgggaggccactgagctcttat
ggaatggatagcagacctcccatggcaatttttgaattgttggattatatagtcaatgag
cctcctccaaaactacccagtggtgtattcagtctggaatttcaagattttgtgaataaa
tgcttaataaaaaaccccgcagagagagcagatttgaagcaactcatggttcatgctttt
atcaagagatctgatgctgaggaagtagattttgcaggttggctctgctctacaattggc
cttaaccagcccagcacaccaacccatgcagctggtgtctaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510634
Entry
107510634         CDS       T06036                                 

Gene name
MAP2K2
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2 isoform X1
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04066  HIF-1 signaling pathway
ray04068  FoxO signaling pathway
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04140  Autophagy - animal
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04210  Apoptosis
ray04218  Cellular senescence
ray04270  Vascular smooth muscle contraction
ray04370  VEGF signaling pathway
ray04371  Apelin signaling pathway
ray04540  Gap junction
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04613  Neutrophil extracellular trap formation
ray04620  Toll-like receptor signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04720  Long-term potentiation
ray04722  Neurotrophin signaling pathway
ray04730  Long-term depression
ray04810  Regulation of actin cytoskeleton
ray04910  Insulin signaling pathway
ray04912  GnRH signaling pathway
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04917  Prolactin signaling pathway
ray04919  Thyroid hormone signaling pathway
ray04921  Oxytocin signaling pathway
ray04926  Relaxin signaling pathway
ray04929  GnRH secretion
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
ray05135  Yersinia infection
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05210  Colorectal cancer
ray05211  Renal cell carcinoma
ray05213  Endometrial cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05216  Thyroid cancer
ray05218  Melanoma
ray05219  Bladder cancer
ray05220  Chronic myeloid leukemia
ray05221  Acute myeloid leukemia
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05230  Central carbon metabolism in cancer
ray05231  Choline metabolism in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107510634 (MAP2K2)
   04012 ErbB signaling pathway
    107510634 (MAP2K2)
   04014 Ras signaling pathway
    107510634 (MAP2K2)
   04015 Rap1 signaling pathway
    107510634 (MAP2K2)
   04370 VEGF signaling pathway
    107510634 (MAP2K2)
   04371 Apelin signaling pathway
    107510634 (MAP2K2)
   04066 HIF-1 signaling pathway
    107510634 (MAP2K2)
   04068 FoxO signaling pathway
    107510634 (MAP2K2)
   04072 Phospholipase D signaling pathway
    107510634 (MAP2K2)
   04071 Sphingolipid signaling pathway
    107510634 (MAP2K2)
   04024 cAMP signaling pathway
    107510634 (MAP2K2)
   04022 cGMP-PKG signaling pathway
    107510634 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    107510634 (MAP2K2)
   04150 mTOR signaling pathway
    107510634 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107510634 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    107510634 (MAP2K2)
   04218 Cellular senescence
    107510634 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107510634 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    107510634 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107510634 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107510634 (MAP2K2)
   04620 Toll-like receptor signaling pathway
    107510634 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    107510634 (MAP2K2)
   04660 T cell receptor signaling pathway
    107510634 (MAP2K2)
   04662 B cell receptor signaling pathway
    107510634 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    107510634 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107510634 (MAP2K2)
   04929 GnRH secretion
    107510634 (MAP2K2)
   04912 GnRH signaling pathway
    107510634 (MAP2K2)
   04915 Estrogen signaling pathway
    107510634 (MAP2K2)
   04917 Prolactin signaling pathway
    107510634 (MAP2K2)
   04921 Oxytocin signaling pathway
    107510634 (MAP2K2)
   04926 Relaxin signaling pathway
    107510634 (MAP2K2)
   04935 Growth hormone synthesis, secretion and action
    107510634 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    107510634 (MAP2K2)
   04916 Melanogenesis
    107510634 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107510634 (MAP2K2)
  09156 Nervous system
   04720 Long-term potentiation
    107510634 (MAP2K2)
   04730 Long-term depression
    107510634 (MAP2K2)
   04722 Neurotrophin signaling pathway
    107510634 (MAP2K2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107510634 (MAP2K2)
   05206 MicroRNAs in cancer
    107510634 (MAP2K2)
   05205 Proteoglycans in cancer
    107510634 (MAP2K2)
   05230 Central carbon metabolism in cancer
    107510634 (MAP2K2)
   05231 Choline metabolism in cancer
    107510634 (MAP2K2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107510634 (MAP2K2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107510634 (MAP2K2)
   05225 Hepatocellular carcinoma
    107510634 (MAP2K2)
   05226 Gastric cancer
    107510634 (MAP2K2)
   05214 Glioma
    107510634 (MAP2K2)
   05216 Thyroid cancer
    107510634 (MAP2K2)
   05221 Acute myeloid leukemia
    107510634 (MAP2K2)
   05220 Chronic myeloid leukemia
    107510634 (MAP2K2)
   05218 Melanoma
    107510634 (MAP2K2)
   05211 Renal cell carcinoma
    107510634 (MAP2K2)
   05219 Bladder cancer
    107510634 (MAP2K2)
   05215 Prostate cancer
    107510634 (MAP2K2)
   05213 Endometrial cancer
    107510634 (MAP2K2)
   05224 Breast cancer
    107510634 (MAP2K2)
   05223 Non-small cell lung cancer
    107510634 (MAP2K2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107510634 (MAP2K2)
   05022 Pathways of neurodegeneration - multiple diseases
    107510634 (MAP2K2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107510634 (MAP2K2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107510634 (MAP2K2)
   05135 Yersinia infection
    107510634 (MAP2K2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107510634 (MAP2K2)
   05170 Human immunodeficiency virus 1 infection
    107510634 (MAP2K2)
   05161 Hepatitis B
    107510634 (MAP2K2)
   05160 Hepatitis C
    107510634 (MAP2K2)
   05164 Influenza A
    107510634 (MAP2K2)
   05163 Human cytomegalovirus infection
    107510634 (MAP2K2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107510634 (MAP2K2)
   05165 Human papillomavirus infection
    107510634 (MAP2K2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107510634 (MAP2K2)
   01522 Endocrine resistance
    107510634 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107510634 (MAP2K2)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     107510634 (MAP2K2)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: STE group
  STE7 family
   107510634 (MAP2K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo CAMSAP_CC1
Other DBs
NCBI-GeneID: 107510634
NCBI-ProteinID: XP_015999822
LinkDB
Position
Unknown
AA seq 400 aa
MLARRKPVLPALTINPAIAEGPSPTSEGASEANLVDLQKKLEELELDEQQKKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQ
GTHYSVQSDIWSMGLSLVELSIGRYPIPPPDAKELEAIFGRPMVDGAEGEPHSISPRPRP
PGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPSGVFTQDFQEFVNKCLVKNPAERADL
KMLMNHTFIKRSEVEEVDFAGWLCKTLRLDQPSTPTRTAV
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgctgccggcgctcaccatcaaccctgccatcgccgag
ggcccgtcccccaccagcgagggcgcctccgaagcaaacttggtggacctccagaagaag
ctagaggagctcgagctcgacgagcagcagaagaagcggctggaagccttcctcacccag
aaggccaaggtcggggagctcaaggacgatgacttcgaaaggatctcggagctgggagcc
gggaacggcggggtggtcaccaaggtccagcacagaccttcgggtctcatcatggcaaga
aagctgatccacctggagatcaagccagccatccggaaccagatcatccgcgagctgcag
gtgctgcacgagtgcaactcgccgtacatcgtgggcttctacggggccttctacagcgac
ggggagatcagcatctgcatggagcacatggacggcggctccctggaccaggtgctgaag
gaagccaagagaattccggaggagatcctggggaaggtcagcatcgcggtgctgcggggc
ctggcgtatctccgggagaagcaccagatcatgcaccgagatgtgaagccgtccaacatc
ctcgtcaactccagaggggagatcaagctgtgcgacttcggggtgagcgggcagctcatc
gactccatggccaactccttcgtgggaacgcggtcctacatgtctccggagcggttgcag
ggcacccactactcggtgcagtcggacatctggagcatgggcctgtccctagtggagctg
tccatagggcggtaccccatccccccaccagacgccaaggagctggaggccatctttggc
cggcccatggtcgacggagcagaaggagagcctcacagcatctcaccgcggccgagaccc
cccggacgtcccatcagtggtcacgggatggacagccggccagccatggccatcttcgag
ttgctggactacattgtgaacgagcctcctcccaagctgcccagcggcgtcttcacccag
gacttccaggagtttgtgaataaatgtctggtcaagaatccggccgagcgcgcggacctg
aagatgctcatgaatcacaccttcatcaaacggtccgaggtggaggaagtcgattttgct
ggctggctgtgtaagacgctgcgtctggaccagcccagcacgcccacgcggaccgccgtg
tga

DBGET integrated database retrieval system