KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508948
Entry
107508948         CDS       T06036                                 

Gene name
RAB11A
Definition
(RefSeq) ras-related protein Rab-11A
  KO
K07904  Ras-related protein Rab-11A
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04144  Endocytosis
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04962  Vasopressin-regulated water reabsorption
ray04972  Pancreatic secretion
ray05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107508948 (RAB11A)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    107508948 (RAB11A)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107508948 (RAB11A)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107508948 (RAB11A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    107508948 (RAB11A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107508948 (RAB11A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107508948 (RAB11A)
   04031 GTP-binding proteins [BR:ray04031]
    107508948 (RAB11A)
Membrane trafficking [BR:ray04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    107508948 (RAB11A)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107508948 (RAB11A)
  Exosomal proteins of colorectal cancer cells
   107508948 (RAB11A)
GTP-binding proteins [BR:ray04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    107508948 (RAB11A)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase AAA_22 GTP_EFTU AAA_16 PduV-EutP FeoB_N ABC_tran NTPase_1 Gtr1_RagA SRPRB TniB AAA_14 AAA_24 FAD-SLDH MCM AAA_5 AAA_21
Other DBs
NCBI-GeneID: 107508948
NCBI-ProteinID: XP_015996502
LinkDB
Position
Unknown
AA seq 216 aa
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
LVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQ
MSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI
NT seq 651 nt   +upstreamnt  +downstreamnt
atgggcacccgcgacgacgagtacgactacctcttcaaagttgtccttattggagattct
ggtgttggaaagagtaacctcctgtctcgatttactcgaaatgagtttaatctcgaaagc
aagagcaccattggagtagagtttgcaacaagaagcatccaggttgatgggaaaacaata
aaggcacagatatgggacacggcagggcaagagcgataccgagctataacatcagcatac
taccgtggagctgtaggtgccttattggtttatgacattgctaaacatctcacatatgaa
aatgtagagcgatggctgaaagaactgagagatcatgctgatagtaacattgttatcatg
cttgtgggcaataagagtgatttacgtcatctcagggcagttcctacagatgaagcaaga
gcttttgcagaaaagaatggtttgtcattcattgagacatctgctctagattctacaaat
gtagaagctgcttttcagacaattctgacagagatataccgcattgtttcccagaagcag
atgtcagacagacgtgaaaatgacatgtctccaagcaacaatgtggttcctattcatgtt
ccaccaaccactgaaaacaagccaaaggtgcaatgctgtcagaacatataa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519907
Entry
107519907         CDS       T06036                                 

Gene name
RAB11B
Definition
(RefSeq) ras-related protein Rab-11B
  KO
K07905  Ras-related protein Rab-11B
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04144  Endocytosis
ray04152  AMPK signaling pathway
ray04962  Vasopressin-regulated water reabsorption
ray05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    107519907 (RAB11B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107519907 (RAB11B)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107519907 (RAB11B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    107519907 (RAB11B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107519907 (RAB11B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107519907 (RAB11B)
   04031 GTP-binding proteins [BR:ray04031]
    107519907 (RAB11B)
Membrane trafficking [BR:ray04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    107519907 (RAB11B)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107519907 (RAB11B)
  Exosomal proteins of other body fluids (saliva and urine)
   107519907 (RAB11B)
  Exosomal proteins of colorectal cancer cells
   107519907 (RAB11B)
GTP-binding proteins [BR:ray04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    107519907 (RAB11B)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase AAA_22 GTP_EFTU AAA_16 PduV-EutP FeoB_N ABC_tran Gtr1_RagA NTPase_1 SRPRB TniB AAA_14 FAD-SLDH AAA_24 Ploopntkinase3 AAA_5 AAA_21
Other DBs
NCBI-GeneID: 107519907
NCBI-ProteinID: XP_016018571
LinkDB
Position
Unknown
AA seq 218 aa
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
LVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQ
IADRAAHDESPGNNVVDISVPPTTDGQKPNKLQCCQNL
NT seq 657 nt   +upstreamnt  +downstreamnt
atggggacccgggacgacgagtacgactacctattcaaagtggtgctcatcggggactca
ggcgtggggaaaagcaacctgctgtcccgtttcacccgcaacgagttcaacctggagagc
aagagcaccattggagtggagttcgccacccgcagcatccaggtggacggcaagaccatc
aaggcacagatctgggacaccgctggtcaggagcgctaccgcgccatcacctctgcgtat
taccgtggagcagtgggagcattactggtgtatgacatcgccaagcacctgacttacgag
aatgtggagcgctggctgaaggagctgcgggatcacgctgacagcaacattgtcatcatg
ctggtgggcaacaagagtgacctgcgccacctgcgggctgtgcccactgacgaggctcgt
gcctttgcagagaagaacaacctgtccttcattgagacctcagccttggactccaccaat
gtggaagaagctttcaagaacatcctcacagagatctaccgtattgtgtcacagaagcag
attgcagatcgcgcagcacacgacgagtcccccggcaacaatgtggtggacatcagcgtg
ccacccactaccgacggacagaaaccgaacaagctgcagtgctgccagaacctgtga

DBGET integrated database retrieval system