KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509004
Entry
107509004         CDS       T06036                                 

Gene name
CACNA1E
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent R-type calcium channel subunit alpha-1E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04020  Calcium signaling pathway
ray04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107509004 (CACNA1E)
   04020 Calcium signaling pathway
    107509004 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107509004 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107509004 (CACNA1E)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107509004 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 107509004
NCBI-ProteinID: XP_015996626
LinkDB
Position
Unknown
AA seq 2344 aa
MKRRRGGLIEQRDIIKAHEAHKMQSTPQARRKEWEMARFGEAVVARPGSGDGDSDQSRNR
QGTPVPASGPAAAYKQSKAQRARTMALYNPIPVRQNCFTVNRSLFIFGEDNIVRKYAKKL
IDWPPFEYMILATIIANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVA
LGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIP
SLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACFMNNSGILEGFDPP
HPCGVQGCPAGYECKDWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGAT
WNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRA
WIDKAEEVMLAEENKNTGTSALEVLRRATIKRSRTEAMTRDSSDEHCVDISSVGTPLARA
SIKSTKVDGASYFRHKERLLRISVRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPQWLT
HLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSFNCFDFGVTVGSIFEVVWAIFRPGTS
FGISVLRALRLLRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLF
GGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIV
LTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPS
IERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQRTSQLRRHMQMSSQEALNKEDAPPM
NPLNPLNPLSPLNPLNAHPSLYRRPRALEGLALGLEKCEEERVSRGGSLKGPGGDLSSAL
DNQKSPLSLGKREPPWPARPCHGNCDPTQQEARAGETVVTFEDRARHRQSQRRSRHRRVR
TEGKELSSASRSRSASQERSLDEGAPADGDRGREPRGSRAAKEPTIQEEERAQHLRRTNS
LMVPRGSGLAGALDEADTPLVPPEPEPDVGKDPALPEPEGSSEQALLGEVQLDVGRAISQ
SEPDLSCATANTDKATTESTSVTVAIPDVDPLVDSAVVHISNKTDGEASPLKEAEVKEEE
EGPEKPQQQEKRETGKAMVPHSSMFIFSTTNPIRRACHYIVNLRYFEMCILLVIAASSIA
LAAEDPVLTNSERNRVLRYFDYVFTGVFTFEMVIKMVDQGLILQDGSYFRDLWNILDFIV
VVGALVAFALANALGSNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNV
FNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKECIGNYVDHEKNKMEVKGREWK
RHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVV
FPFFFVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQSRHTFQY
RVWHFVVSPSFEYTIMAMIALNTIVLMMKYYSAPCTYELALKYLNIAFTMVFSLECVLKV
IAFGFLNYFRDTWNIFDFITVIGSITEIILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQ
GYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSF
FGSLMLLFRSATGEAWQEIMLSCLGEKGCEPDTTAPSGQSETERCGTDLAYVYFVSFIFF
CSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACGRIHYTEMYEMLT
LMSPPLGLGKRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADRQ
QLDSELQKETLAIWPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQ
LEEQKNAPMFQRMEPSSLPQEIIANAKALPYLQQDPGSGLSGRGGYPAMRPLSPQEIFQL
ACMDPADDGQFQEQQSLEPEVSELKSVQPSNHGIYLPPDTQEHAGSGRASSMPRLTVDPQ
VVTDPSSMRRSFSTIRDKRSNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNADS
GHKSDTHRSGGRERGRSKERKHLLSPDVSRCNSEERGTQADWESPERRRSRSPSEGRSQT
PNREGTGSLSESSIPSISDTSTPRRSRRQLPPVPPKPRPLLSYSSLLRHTGSISPPADGS
EGGSLLTAQVLEGGEAGPPASASSRHAQRGPHPSPQRYISEPYLALHEDAHASDCGEEET
LTFEAAVATSLGRANTIGSAPPLRHSWQVPNGHYRRRRRGGPGPGVMCGGVGDLLSDTEE
DDKC
NT seq 7035 nt   +upstreamnt  +downstreamnt
atgaagcggcggcgcggcggcctcatcgagcagcgcgacatcatcaaggcccacgaggcg
cacaagatgcagagcaccccgcaggcccggcgcaaggagtgggagatggctcgcttcggg
gaagcggtggtcgccaggccggggtccggcgatggagactcggaccagagcaggaacagg
caaggaaccccggtgcccgcctcggggcccgcggccgcctacaagcagtcgaaagcgcag
agggcgcggactatggctttgtacaaccccattcccgtccggcagaactgtttcaccgtc
aacagatccctgttcatctttggagaagataacattgtcaggaagtacgccaagaagctc
atcgattggccgccattcgagtacatgatcctggccaccatcattgccaactgcatcgtc
ttggccctggagcagcatcttcccgaggatgacaagaccccgatgtcccgcagactggag
aagacagaaccatatttcattgggatcttttgctttgaagccgggatcaaaatcgtggcc
ctggggttcatcttccataagggctcctaccttcgcaatggctggaatgtcatggacttc
atcgtggtcctcagtggcatcctggccaccgcgggcacccacttcaacacacacgtggac
ctgaggaccctccgggccgtgcgcgtgctcaggccgctgaagctcgtgtcagggatcccc
agcctgcagattgtgttgaagtccatcatgaaggccatggtgcctctcctgcagatcggc
ctcctgctcttctttgccatcctcatgtttgccatcattggcttggagttctacagtggg
aagctgcaccgtgcctgcttcatgaacaattcaggtatcctggaaggattcgacccccct
cacccgtgcggtgtgcagggctgcccagccggctatgaatgcaaggactggatcggcccg
aacgacgggatcacgcagttcgataacatcctttttgcggtgctgaccgtcttccagtgc
atcaccatggaagggtggaccaccgtgctctacaacaccaatgatgccttaggagccacc
tggaattggctgtacttcatccccctcatcatcattggatccttctttgttctcaaccta
gtcctgggagtgctttccggggaatttgccaaagagagagagcgagtggagaaccggaga
gctttcatgaagctgcggcgccagcagcagattgagcgggagctgaacgggtaccgcgcc
tggatagacaaagcggaggaagtcatgcttgcggaggaaaataaaaacactggaacgtca
gccctggaagtgcttcgcagggccaccatcaaacggagccgcacggaggccatgacccga
gactccagcgacgagcactgcgtcgacatctcctccgtgggcacgcctctcgcccgagcc
agcatcaaaagcacaaaggtagacggggcctcctacttccggcacaaggagaggcttctg
cgcatctcggtccgccacatggttaaatcccaggtgttttactggattgtgctgagcctc
gtggctctcaacaccgcctgtgtggccatcgtccaccacaaccagccccagtggctcacc
cacctcctctactatgcagaatttttgtttctgggactcttcctcttggagatgtccctg
aagatgtacggcatggggccgcgcctttatttccactcttcattcaactgctttgatttc
ggggtcacagtgggcagtatcttcgaagtggtctgggccatcttcagacccggaacgtct
tttggaatcagtgtcctgcgggctctccggcttctaagaatatttaaaataaccaagtac
tgggcctcgctgcggaatttggtggtgtccttgatgagctccatgaagtcgatcatcagt
ttgctcttcctcctcttcctcttcatcgtggtctttgctctcctagggatgcagctgttt
ggaggcaggtttaactttaatgatgggactccgtcagcaaacttcgacaccttccctgca
gctatcatgactgtattccagatcctgacgggtgaggactggaacgaggtcatgtacaac
ggcatccgctcccagggcggggtcagctcgggcatgtggtcggctatctatttcatcgtg
ctcaccttgtttggaaactacacgctgctgaacgtgttcttggccattgccgtggacaat
ctggccaacgcacaggagctgaccaaggatgaacaggaagaagaagaggccttcaaccag
aaacacgctctgcagaaggccaaggaggtcagcccgatgtctgcgcccaacatgccctcg
atcgaaagagacagaaggagaagacaccacatgtcgatgtgggagccacgcagcagccac
ctgcgggagcggcggcgccggcaccacatgtccgtgtgggagcagcgcaccagccagctg
cggcggcacatgcagatgtccagccaggaggccctcaacaaggaggacgcgccgcccatg
aacccgctcaaccccctcaacccgctgagccccctcaacccgctcaacgcgcaccccagc
ctctaccggagaccccgtgccctcgagggcctggccctgggcctggagaagtgcgaggag
gagcgcgtcagccgcggggggtccctcaaggggcccggcggggacctctccagtgccctg
gacaaccagaagagccccttgtccctgggcaagcgggagccgccgtggccggccaggccg
tgccatgggaactgtgacccgacgcagcaggaggctcgggcaggggagaccgtggtgacc
ttcgaggaccgggccaggcacaggcagagccagcggcgaagccggcaccgccgcgtccgg
acggagggcaaggagctgtcctccgcctcccggagccggtccgccagccaggagcggagt
ctggatgagggcgcgcccgccgacggggacaggggccgcgagcccaggggcagccgcgcg
gccaaggagcccacgatccaggaggaggagagggcccagcacctgcggaggaccaacagt
ctgatggtgcccagaggctccgggctggctggggccctcgatgaggcggacacaccgctg
gtcccgcccgagccggagccggacgtgggcaaggaccccgcgctgcccgagccggagggc
agcagcgagcaggcgctgctgggggaggtgcagctggacgtgggccgggccatcagccag
agcgagcctgacctgtcctgcgccacggccaacacggacaaggccaccaccgagagcacc
agcgtcaccgtcgccatccccgatgtggaccccttggtggactcggccgtggtgcacatc
agcaacaagaccgacggcgaagccagcccgctgaaggaggccgaggtcaaagaggaggag
gaggggccggagaagccgcagcagcaggagaagcgagagacaggcaaagccatggtgccc
cacagctccatgtttatcttcagcaccaccaacccgatccgcagggcctgccactacatc
gtgaacctgcgctacttcgagatgtgtatcctcctggtgatcgcggccagcagcatcgcc
ctggcggccgaggaccccgtcctgaccaactcggagcgcaacagagtcctgcggtatttc
gactatgttttcactggtgtgttcaccttcgagatggtgataaagatggtggaccagggc
ctgattctgcaggatgggtcctacttccgagacctgtggaacatccttgacttcatcgtc
gtggtcggtgcactggtggccttcgctttggcgaacgctttgggaagcaacaaagggcgg
gacatcaagaccatcaagtccctgcgggtgctgcgggtgctgcggccgctgaagaccatc
aagcgcctgcccaagctcaaggccgtcttcgactgcgtggtgacctccctgaagaacgtc
ttcaacatcctcatcgtctacaagctcttcatgttcatcttcgccgtcatcgcagtccag
ctcttcaagggcaagttcttctactgcacggacagctccaaggacacggagaaagagtgc
ataggcaactacgtggatcacgagaagaacaagatggaggtgaaaggccgggaatggaag
cgccacgagttccactacgacaacatcatctgggccctgctgaccctcttcaccgtgtcc
acgggggaaggatggcctcaggtcctgcagcactcggtcgacgtgacggaggaggaccgc
ggcccgagccgcagcaaccgcatggagatgtccatcttctacgtggtctacttcgtcgtc
ttccccttcttcttcgtcaacatcttcgtggcgctcatcatcatcaccttccaggagcag
ggggacaagatgatggaggagtgcagcctggagaagaacgagagggcgtgcatcgacttc
gccatcagcgccaagccgctcacgcgctacatgccgcagagcaggcacaccttccagtac
cgcgtctggcacttcgtggtctcgccgtccttcgagtacaccatcatggccatgatcgcc
ctgaacaccatcgtgctgatgatgaagtactattccgccccctgcacctacgagctggcg
ctgaagtacctgaacatcgccttcaccatggtgttctccctggaatgcgtcctgaaggtc
atcgcctttggcttcctgaactacttccgagacacctggaatatcttcgacttcatcacc
gtgatcggcagcatcacagaaatcattctgacagacagcaagctggtgaacaccagtggc
ttcaacatgagcttcctgaagctcttccgggccgcccgcctcatcaagcttctgcgtcag
ggctacaccatccgcattctgctctggaccttcgtgcagtccttcaaggccctcccctac
gtctgcctgctgatcgccatgctcttcttcatctacgccatcatcgggatgcaggtgttt
gggaacataaaattggatgaggagagtcacatcaaccggcacaacaacttccggagcttc
tttgggtccctcatgctgctcttcaggagcgccacgggggaggcctggcaggagatcatg
ctgtcgtgcctcggggagaaaggctgcgagccggacaccacggcgccctcggggcagagc
gagaccgagcgctgcggcaccgacctggcctacgtctacttcgtctccttcatcttcttc
tgctccttcctgatgctcaacctgtttgtggctgtcatcatggacaacttcgagtacctg
actcgggactcgtccatcctggggccgcaccacttggacgagtttgtccgcgtctgggca
gaatatgacagagctgcatgtggccgcatccattacactgagatgtatgaaatgctgact
ctcatgtcaccgccgctaggcctcggcaagagatgtccctccaaagtggcgtataagagg
ttggtcctgatgaatatgccagtagctgaggacatgaccgtccacttcacctccaccctg
atggctctgatccggacagctctggacatcaaaattgccaaaggcggtgccgacaggcag
cagcttgactcggagctacagaaggagaccctggccatctggcctcacctgtcccagaag
atgctcgatctgcttgtgcccatgcccaaagcctctgatctgaccgtgggcaaaatctat
gcagcgatgatgatcatggactactataaacagagcaaggtgaagaagcagaggcagcag
ctggaggaacagaaaaatgcgcccatgttccagcgcatggagccctcatccctgcctcag
gagatcatcgccaacgccaaagctctgccttatctgcagcaggacccggggtcaggcctg
agcggccgtggcgggtaccctgcgatgcgcccgctctccccgcaggaaatattccagttg
gcgtgtatggacccggccgacgacgggcagttccaggagcagcagtctctggagccagag
gttagtgaattaaaaagcgtgcagccctctaaccatggcatctaccttcctccggacacc
caggagcatgcgggatctgggagggcatcctctatgccacgcctgactgtggatccccag
gtggtaacagaccccagctccatgagacgttcgttctctacgatccgggataagcgttcg
aattcctcgtggttggaggaattctccatggagcgaagcagcgaaaacacctacaagtcc
cgtcgccggagctaccactcctccctgcggctgtcggcccaccgcctgaacgcggactcg
ggccacaagtctgacacccaccgctcagggggcagagagcggggacgatcgaaagagcga
aagcaccttctctcccctgacgtgtcccgctgcaactcggaggagcgagggacccaggcg
gactgggagtccccggagcggcggcggtccaggtcccccagcgagggcaggtcgcagacc
cccaacagagagggcacgggctccttgagtgaaagctccatcccctccatctctgacacc
agcaccccaaggcgaagtcggcggcagctgcccccggtccctccgaagccgcggcccctc
ctttcctacagctccctgctccgacacacgggcagcatctctccccccgccgacggcagc
gagggcggctccctcctgacagcccaagtcctggagggcggcgaggcgggcccgcccgcg
tccgccagctcccggcacgcgcagcggggcccgcacccctccccgcagcgctacatctcc
gagccctacctggccctgcacgaagacgcccacgcctcggactgcggcgaggaggagacg
ctcaccttcgaggccgcggtggccaccagcctgggccgcgccaacaccatcggctcggcc
ccgcccctgcggcacagctggcaggtgcccaacgggcactaccggcggcggcggcgcggc
gggccggggcccggcgtgatgtgcggcggcgtcggcgacctcctgagtgacacagaagag
gacgacaagtgctag

DBGET integrated database retrieval system