KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509091
Entry
107509091         CDS       T06036                                 

Gene name
NPR1
Definition
(RefSeq) atrial natriuretic peptide receptor 1
  KO
K12323  atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00230  Purine metabolism
ray01100  Metabolic pathways
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04270  Vascular smooth muscle contraction
ray04714  Thermogenesis
ray04921  Oxytocin signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray04924  Renin secretion
ray04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107509091 (NPR1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107509091 (NPR1)
   04022 cGMP-PKG signaling pathway
    107509091 (NPR1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107509091 (NPR1)
   04921 Oxytocin signaling pathway
    107509091 (NPR1)
   04924 Renin secretion
    107509091 (NPR1)
   04925 Aldosterone synthesis and secretion
    107509091 (NPR1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107509091 (NPR1)
  09159 Environmental adaptation
   04714 Thermogenesis
    107509091 (NPR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107509091 (NPR1)
Enzymes [BR:ray01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107509091 (NPR1)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   107509091 (NPR1)
SSDB
Motif
Pfam: Guanylate_cyc ANF_receptor PK_Tyr_Ser-Thr Pkinase HNOBA Peripla_BP_6
Other DBs
NCBI-GeneID: 107509091
NCBI-ProteinID: XP_015996831
LinkDB
Position
Unknown
AA seq 1056 aa
MPHPGGRAGARLLLLPLLLPLLRGGHAGNLTVAVVLPLANTSYPWSWARVGPAVELALAR
AKARPDLLPGWTVRTVLGSSENARGVCSDTAAPLTAVDLKWEHEPAVFLGPGCVYAAAPV
ARFTAHWRVPLLTAGAPALGFGNKDEYALTTRAGPSHAKLGDVVAALHRRLGWARHALVL
YAYQPDHDRQCFFLAEGLFQSVQERLNITVEHLEFAESAREHYAELLQFVQRKGRVIYIC
SSPDAFRNLMLLAAEAGLSGEDYVFFHLDLFGQSLQGAHGLTPRRPWERGDGLDVSAHKA
FQAAKILTYKEPDSPDYLDFLQQLKRLAQEQFNFTVEDGLVNTIPASFHDGLLLYVQAVT
ETLAHGGTVTDGVGITQRMWNRSFQGVAGYLKIDSNGDRETDFSLWDMDPETGAFRVVLN
YNGTSKELAAVSGRRLHWPLGYPPPDIPRCGFENEDPACNQAHFSTLEVLALVGSLSLLC
ILVVSFFIYRKMQLEKELASELWRVRWEDLQPSSLERHLRSAGSRLTLSGRGSNYGSLFT
TEGQFQVFAKTAYYKGNLVVVKRVNRKRIELTRKVLFELKHMRDVQNEHLTRFVGACTDP
PNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGSICSHGNLKSSN
CVVDGRFVLKITDYGLESFRDPEPEQGHILYAKKLWTAPELLRMSSPPARGSQAGDVYSF
GIILQEIALRSGAFHLEGLDLSPKEIVERVIRGEQPPFRPSPALQSHLEELAHLMQRCWA
EDPQERPPFQQIRLTLRKFNRENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKGKA
EALLYQILPHSVAEQLKRGETVQAEAFDSVTIHFSDIVGFTALSAESTPMQVVTLLNDLY
TCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHAREVARMALALLDAVRSFRIRHRP
QEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAVLE
EFGGFELELRGDVEMKGKGKVRTYWLLGERGTSTRG
NT seq 3171 nt   +upstreamnt  +downstreamnt
atgccgcaccccgggggccgcgcgggcgcccgcctgctgctgctgccgctgctgctgccg
ctgctccggggcggccacgcgggcaacctgacggtggccgtggtgctgccgctggccaac
acctcgtacccgtggtcgtgggcacgcgtgggcccggccgtggagctggccctggcccgg
gcgaaggcgcggcccgacctgctgccgggctggacggtccgcacggtgctgggcagcagc
gagaacgcgcgcggcgtctgctccgacaccgccgcgccgctcaccgccgtggacctcaag
tgggagcacgagccggccgtgttcctgggccccggctgcgtgtacgccgccgcgcccgtg
gcgcgcttcaccgcgcactggcgcgtgccgctgctcacggccggcgcccccgcgctgggc
ttcggcaacaaggacgagtacgcgctgaccacgcgcgccgggcccagccacgccaagctg
ggcgacgtggtggccgcgctgcaccgacggctgggctgggcgcgccacgcgctcgtgctc
tacgcctaccagccggaccacgaccggcagtgcttcttcctcgccgaggggctgttccag
agcgtgcaggagcgcctcaacatcaccgtggagcacctggagttcgccgagagcgcccgc
gagcactacgccgagctgctgcagttcgtgcagcgcaagggccgcgttatctacatctgc
agctcgccggatgccttcagaaacctgatgcttctggccgcggaagctggcctgagtggc
gaggactacgtctttttccacctggacctcttcgggcaaagcctgcaaggtgcacacgga
cttactccccgcaggccctgggagagaggcgacgggctggatgtcagtgcccacaaggcc
tttcaggccgccaaaatcctcacatacaaagagccggactcccctgactacctggacttc
ctgcagcagctgaagcggctggcccaggagcagttcaacttcacggtggaggacggcctg
gtgaacaccatcccagcgtccttccacgacgggctcctgctctatgtccaggcagtgacc
gagacgctggcacatggggggactgtcaccgatggcgtgggcatcacccagcggatgtgg
aaccggagcttccaaggtgtggcgggatacctgaagatagacagcaatggagaccgggag
actgacttctccctctgggacatggaccctgagacgggcgccttcagggtcgtcctgaac
tacaacgggacttccaaagagctggcggctgtgtcggggcgccgactgcactggcccctg
gggtacccgcctcctgacatccccagatgcggctttgagaatgaggacccagcctgcaac
caagcccacttttccaccctggaggtgctggctctggtgggcagcctctccctgctctgc
atcctcgtcgtctccttcttcatatacaggaagatgcagctggagaaggaactggcctca
gagctgtggcgggtgcgttgggaggacctgcagcccagcagcctcgagcggcaccttcgg
agcgcgggcagccgactgaccttgagtgggcgaggctccaattacggctccctgttcacc
accgagggccagttccaagtcttcgccaagaccgcgtattataagggcaacctcgtggtt
gtgaaacgcgtgaaccgtaaacgcatcgagctgacaagaaaagtcctgtttgagctgaag
catatgcgggacgtgcagaacgaacacctgacccggttcgtgggcgcctgtaccgacccc
cccaacatctgtatcctcacggagtactgtccccgtgggagcctgcaggacattctggag
aacgagagcatcaccctggactggatgttccggtactccctcaccaacgacatcgtcaag
gggatgctgtttctacacaacgggtccatttgctcccacgggaacctgaagtcgtccaac
tgcgtggtagacggacgcttcgtgctcaagatcaccgactacgggctggagagcttcagg
gacccagagccagagcaaggacacatcctctatgccaaaaagctgtggacagcccccgag
ctcctgcgcatgtcctcgccgcctgcgcgcggctcccaggccggcgacgtctacagcttc
ggcatcattcttcaggagatcgccctgaggagcggtgccttccacctggaaggattggac
ctgagccccaaagagatcgtggagcgcgtgatccgcggcgagcagccgccgttccggccg
tccccggccctgcagagtcacctggaggagctggcgcacctgatgcagcggtgctgggct
gaggacccgcaggagcggccgcccttccagcagatccgcctgacgctgcgcaagttcaac
agggagaacagcagcaacatcctggacaacttgctgtcccgcatggagcagtacgccaac
aacctggaggagctggtggaggagcgcacccaggcctacctggaggagaagggcaaggcc
gaggccctgctctaccagatcctgccccactcggtggctgagcagctgaagcgcggggag
accgtccaggccgaagccttcgacagcgtgactatccacttcagcgacatcgtggggttc
acggccctgtcagcagagagcacgcccatgcaggtggtgaccttgctcaacgacctgtac
acttgcttcgatgccgttatagacaacttcgacgtgtacaaggtggagacgatcggggac
gcctacatggtggtgtccgggctgccagtgcgcaacgggcggctgcacgcgcgcgaggtg
gcccgcatggccctggcgctgctcgacgccgtgcgctccttccgcatccgccaccggccc
caggagcagctgcgcttgcgcatcggcatccacacgggacccgtgtgcgccggcgtggtg
gggctgaagatgccccgttactgtctctttggggacacagtcaacacggcctcaagaatg
gagtcgaacggggaagccctgaagatccacctgtcttctgagaccaaggctgtgctggag
gagttcgggggcttcgagctggagcttcgtggggatgtggaaatgaagggcaaaggcaaa
gttcgcacctactggctcctgggggagcgggggactagcacccgaggttga

DBGET integrated database retrieval system