KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509109
Entry
107509109         CDS       T06036                                 

Gene name
MYL3
Definition
(RefSeq) myosin light chain 3
  KO
K12749  myosin light chain 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray04371  Apelin signaling pathway
ray05410  Hypertrophic cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107509109 (MYL3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107509109 (MYL3)
   04261 Adrenergic signaling in cardiomyocytes
    107509109 (MYL3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107509109 (MYL3)
   05414 Dilated cardiomyopathy
    107509109 (MYL3)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     107509109 (MYL3)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 DUF5716
Other DBs
NCBI-GeneID: 107509109
NCBI-ProteinID: XP_015996867
LinkDB
Position
Unknown
AA seq 196 aa
MAPKKPEPKKEEAKAAAAPKAAPAPAAPEAERPKEAEFDASKIKIEFTPEQIEEFKEAFM
LFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEELNTKMMDFETFLPMLQ
HIAKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEDEVEKLMAGQEDS
NGCINYEAFVKHIMAS
NT seq 591 nt   +upstreamnt  +downstreamnt
atggcccccaaaaagccagagcccaagaaggaagaggcgaaggcagcagcagcccccaag
gcggctccagctcctgctgccccagaggctgagcgccccaaggaggcagagtttgatgcc
tccaagatcaagatcgagtttactccggagcagattgaagagttcaaggaagccttcatg
ctgttcgaccgcacgcccaagtgtgagatgaagatcacgtacgggcagtgtggggacgtc
ctgcgggcgctgggccagaaccccacacaggccgaggtgctccgtgtgctggggaagcca
aagcaggaagagctcaacaccaagatgatggacttcgaaacgttcctgcccatgctgcag
cacatcgccaagaacaaggacacgggcacctacgaggacttcgtggaggggctgcgggtc
ttcgacaaggagggcaacggcacggtcatgggcgctgagctccgccacgtgctggccacg
ctgggtgagaggctgacggaagatgaggtggagaaattgatggccgggcaagaagactcc
aacggctgcatcaactacgaagccttcgtgaagcacatcatggccagctga

DBGET integrated database retrieval system