KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509178
Entry
107509178         CDS       T06036                                 

Gene name
MITF
Definition
(RefSeq) microphthalmia-associated transcription factor isoform X1
  KO
K09455  microphthalmia-associated transcription factor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04137  Mitophagy - animal
ray04380  Osteoclast differentiation
ray04916  Melanogenesis
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05218  Melanoma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107509178 (MITF)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107509178 (MITF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107509178 (MITF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107509178 (MITF)
   05202 Transcriptional misregulation in cancer
    107509178 (MITF)
  09162 Cancer: specific types
   05218 Melanoma
    107509178 (MITF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107509178 (MITF)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    107509178 (MITF)
SSDB
Motif
Pfam: MITF_TFEB_C_3_N DUF3371 HLH Polysacc_deac_2 DUF726
Other DBs
NCBI-GeneID: 107509178
NCBI-ProteinID: XP_015996985
LinkDB
Position
Unknown
AA seq 549 aa
MTSVLSPLDFQLCGVLFCNLIIFAQAHFIAWCNLGYPKMQMKGLIRKLNVHFFWFSHSSS
EEHPGASKPPISSSTMTSRILLRQQLMREQMQEQERREQQQKLQAAQFMQQRVPVSQTPA
INVSVPTTLPSATQVPMEVLKVQTHLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLS
LPCPNQPGDHVMPPVPGSSAPNSPMAMLTLNSNCEKEGFYKFEEQNRAESECPTMNTHSR
ASCMQMDDVIDDIISLESSYNEEILSLMDPALQMANTLPVSGNLIDLYGNQGLPPPGLTI
SNSCPANLPNIKRELTACIFPTESEARALAKERQKKDNHNLIERRRRFNINDRIKELGTL
IPKSNDPDMRWNKGTILKASVDYIRKLQREQQRAKELENRQKKLEHANRHLLLRIQELEM
QARAHGLSLIPSTGLCSPDLVNRIIKQEPSLENCSQDLLQHHADLTCTTTLDLTDGTITF
NNNLGTGTESGQAYSVPTKMGSKLEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSM
SMEETEHAC
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgacttcagtcctgtcacctcttgattttcaattatgtggagtactattctgcaacttg
attatatttgcacaagctcatttcatagcttggtgcaatttagggtaccccaaaatgcaa
atgaagggtctcattaggaaactaaatgtacattttttttggttttcccacagcagttcc
gaggagcatcctggggcctccaagcctccaataagctcctccactatgacatcacgcatc
ttgctacgccagcaactcatgcgtgagcagatgcaggagcaggagcgcagggagcagcag
cagaagctgcaggcggcccagttcatgcaacagagagtgcctgtgagtcagacaccagcc
ataaacgtcagtgtgcccaccacccttccctctgccacgcaggtgccgatggaagtcctt
aaggtgcagacccacctcgaaaaccccaccaagtaccacatacagcaagcccaaaggcag
caggtaaagcagtacctttctaccactttagcaaataaacatgccaaccaagtcctgagc
ttgccatgtccaaaccagcctggcgatcatgtcatgccaccagtgccggggagcagcgca
cccaacagccccatggctatgcttacacttaactccaactgtgaaaaagagggattttat
aaatttgaagaacaaaacagggcggagagcgaatgcccaacaatgaacacgcactcacga
gcatcatgcatgcagatggatgatgttatcgatgacatcattagcctagaatcaagttat
aatgaagaaatcctgagcttgatggaccctgccttgcaaatggcaaatacgttacctgtc
tctggaaacttgattgacctttatggcaatcaaggactgccacccccaggcctcaccatc
agcaactcttgtccagccaaccttcccaacataaaaagggagcttacagcgtgtattttt
cccacagagtctgaagcaagagctttggctaaagagaggcaaaaaaaggacaatcacaac
ttgattgaacgaagaagaagatttaacataaatgaccgcattaaagaactaggtactttg
attcccaagtcaaatgatccagacatgcgctggaacaaaggaaccattttaaaagcttct
gtggactatatccgaaagttgcaacgagaacaacaacgcgcaaaagaacttgaaaaccgg
cagaagaaactggagcacgccaaccggcatctgttgctcagaatacaggaacttgaaatg
caggctcgagcacatggactttcccttattccatccacgggtctctgctctccagatttg
gtgaatcggatcatcaagcaagaaccttctcttgagaactgcagccaagaccttcttcag
catcacgcagatctaacttgtacaacaacccttgatctcacagacggcaccatcaccttt
aacaacaaccttggaaccgggactgagagcggccaagcctatagtgtccccacgaaaatg
ggatctaaactggaagacatcctgatggatgatactctttctcctgttggcgtaactgat
ccacttctttcctctgtgtcccctggagcttccaaaacaagcagccgaaggagcagtatg
agcatggaagaaactgagcatgcctgttag

DBGET integrated database retrieval system