KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509325
Entry
107509325         CDS       T06036                                 

Gene name
ESR2
Definition
(RefSeq) estrogen receptor beta isoform X1
  KO
K08551  estrogen receptor beta
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04915  Estrogen signaling pathway
ray04917  Prolactin signaling pathway
ray04929  GnRH secretion
ray05200  Pathways in cancer
ray05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    107509325 (ESR2)
   04915 Estrogen signaling pathway
    107509325 (ESR2)
   04917 Prolactin signaling pathway
    107509325 (ESR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107509325 (ESR2)
  09162 Cancer: specific types
   05224 Breast cancer
    107509325 (ESR2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107509325 (ESR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107509325 (ESR2)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ray03310]
    107509325 (ESR2)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    107509325 (ESR2)
Nuclear receptors [BR:ray03310]
 3. Estrogen like
  3A. Estrogen receptor
   107509325 (ESR2)
SSDB
Motif
Pfam: ERbeta_N zf-C4 Hormone_recep Alveol-reg_P311
Other DBs
NCBI-GeneID: 107509325
NCBI-ProteinID: XP_015997252
LinkDB
Position
Unknown
AA seq 576 aa
MSLCGSSHKEFSQMLPIQDMDIKNSPSSLNSPASYNCSQSVLPLEHGPIYIPSSYVESHH
EYSTMTFYNPAVMNYSIPSSATNSEGGPGRQTTSSNVLWPTPGHLSPLALHCQSSLLYAE
PQKSPWCEARSLEHTLPVNRETLKRKVSGSSCASPVTSPSSKRDAHFCAVCSDYASGYHY
GVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRR
ERCGYRIVRRQRNSDEQLHCLSKAKKNSGHVSRVKELLLSALGPEQLVLTLLEAEPPNVL
VSRPSAPFTESSMMMSLTKLADKELVHMIGWAKKIPGFVELGLYDQVRLLESCWMEVLMV
GLMWRSIDHPGKLIFAPDLVLDRLLQRENLNLLRMRGKSGYLTLFLTRDEGKCVEGILEI
FDMLLAMTSRFRELKLQHKEYLCVKAMILLNSSMYPLGAPAQEAESSRKLTHLLNAVIDA
LVWVIAKSGIPSQQQSVRLANLLMLLSHVRHTSNKGMEHLLSMKCKNMVPVYDLLLEMLN
AHTLRGHKSSVTGSKYSPAEKSKSKEGSQNPRLSDA
NT seq 1731 nt   +upstreamnt  +downstreamnt
atgtcactttgtggctcttctcacaaggagttttctcagatgttacctattcaagacatg
gatatcaaaaactcaccatctagccttaattctcctgcctcctacaactgcagtcaatct
gtccttcctctggagcacggccccatatacataccttcctcttatgtagagagccaccat
gaatattcaacaatgacattctataaccctgctgtgatgaattacagtattcccagcagt
gccactaactcagaaggtgggcccggtcgacagaccacaagctcaaatgtgttgtggcca
actcctgggcacctctctcctttagcgctccattgccagtcgtcacttctgtatgcagaa
cctcaaaagagtccttggtgtgaagcaagatcactagaacacaccttacctgtaaacaga
gagacactgaaaaggaaggttagtgggagcagttgtgccagccctgttactagtccaagt
tcaaagagggatgcccacttctgtgcagtctgcagtgactacgcgtcaggatatcactat
ggcgtctggtcgtgtgaaggatgtaaagccttttttaaaagaagcattcaaggacataac
gattatatttgtccagctacaaatcagtgtacaatagacaagaaccggcgcaaaagctgc
caggcctgccgacttcggaagtgctatgaagtcggaatggtgaagtgtggctccaggagg
gaaaggtgtggataccgcatagtaagaaggcagagaaattccgacgagcagctgcactgc
ctgagcaaagctaagaaaaacagtggtcatgtgagccgagtgaaggagctgctgctgagc
gccctgggccctgagcagctggtgctcacgctcctggaggcagaaccgcccaatgtgctg
gtgagccgccccagcgcacccttcaccgaatcctccatgatgatgtccctgaccaagctg
gctgacaaggaactggtgcacatgattggctgggccaagaaaattcccggcttcgtggag
cttggcctgtatgaccaagtgcggctgctggagagctgctggatggaggtgctgatggtg
gggctgatgtggcgctccatagaccaccccggcaagctcatctttgccccagaccttgtt
ctggacaggcttctgcagagagaaaacttgaacctactgaggatgagaggaaaatccggt
tatctcaccttatttctaacaagggatgaagggaaatgcgtggaaggaattctggaaatc
tttgacatgctcctggcaatgacttcaaggtttcgtgagctaaaactccaacacaaagag
tatctctgtgtcaaggccatgatcctcctgaactccagtatgtaccctctaggtgcacca
gcacaggaggctgagagcagccggaagctgactcacttactgaacgccgtgatcgatgct
ctggtctgggtgatcgccaagagtggcatcccctcccagcagcagtccgtccgcctggct
aacctcctgatgctcctttcacatgtcaggcacaccagtaacaagggcatggaacacctg
ctcagcatgaagtgcaaaaacatggtcccagtctacgacctgctgctggagatgctgaat
gcccacacgcttcgaggacacaagtcttcagtcacagggtccaagtacagcccagcagag
aagagtaagagcaaagagggctcccagaaccctcggctcagtgatgcctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513028
Entry
107513028         CDS       T06036                                 

Gene name
ESR1
Definition
(RefSeq) estrogen receptor isoform X1
  KO
K08550  estrogen receptor alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04915  Estrogen signaling pathway
ray04917  Prolactin signaling pathway
ray04919  Thyroid hormone signaling pathway
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107513028 (ESR1)
   04917 Prolactin signaling pathway
    107513028 (ESR1)
   04919 Thyroid hormone signaling pathway
    107513028 (ESR1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    107513028 (ESR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107513028 (ESR1)
   05205 Proteoglycans in cancer
    107513028 (ESR1)
  09162 Cancer: specific types
   05224 Breast cancer
    107513028 (ESR1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107513028 (ESR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107513028 (ESR1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ray03310]
    107513028 (ESR1)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    107513028 (ESR1)
Nuclear receptors [BR:ray03310]
 3. Estrogen like
  3A. Estrogen receptor
   107513028 (ESR1)
SSDB
Motif
Pfam: Oest_recep Hormone_recep zf-C4 ESR1_C
Other DBs
NCBI-GeneID: 107513028
NCBI-ProteinID: XP_016004644
LinkDB
Position
Unknown
AA seq 596 aa
MNMTPHTKASGMALLHQIQGSELEPLTHPQLKIPLERPLGEVYVESSKPAVYDYPEGAAY
DFNAAVASTPVYGQSGLAYGPGSEAAAFGANGLGGFPPLNSVSPSSLVLLHQPPQLSPFL
HPHGQQVPYYLENEPNGYAVREAGPPTFYRPNSDNRHQSGRERLASTGEKGSRAMESAKE
TRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGNRHNDYMCPATNQCTIDKNRRKSCQA
CRLRKCYEVGMMKGGIRKDRRGGRILKPKRQRDDGENRNEAGSSGDMRAASMWSNPLLIK
HPKKSSPALSLTADQMVSALLEAEPPLLYSEYDSTRPFSEASMMGLLTNLADRELVHMIN
WAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVE
GMVEIFDMLLATSSRFRMINLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVL
DKIIDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDL
LLEMLDAHRMRSATNRGGTPMAETHPSHMAAPAPTSSHSLQTYYISGEAESFPGTI
NT seq 1791 nt   +upstreamnt  +downstreamnt
atgaacatgacccctcacaccaaagcgtccgggatggctctgctgcaccagatccaaggg
agtgagctggagccgctgacccacccgcagctcaagatccccctggagaggcccctgggc
gaggtgtacgtggagagcagcaagcccgctgtctacgattacccagagggcgccgcgtat
gacttcaacgccgcggtcgcctccacgccggtttacggccagtccggccttgcctacggc
ccagggtccgaagcagcggcgttcggtgccaatggcctggggggcttcccgccgctcaac
agtgtgtcgccgagctcgctggtgctgctgcaccagccgccgcagctctcacccttcctg
cacccccacggccagcaggtgccctattacctggagaacgagccgaacggctatgcggtg
cgcgaggctggccctcccaccttctacaggccaaattcagataatcggcaccagagtggc
agagagagattggccagcaccggtgagaagggaagcagggccatggaatctgccaaggag
actcgctactgtgcagtgtgcaatgactatgcctcaggctaccattatggagtctggtcc
tgcgagggctgtaaggccttcttcaagagaagtattcaaggtaatagacataacgactac
atgtgtccagctaccaaccagtgcacaattgataaaaacaggaggaagagctgtcaggcc
tgccggctacgcaagtgctacgaagtgggcatgatgaaaggtgggatacggaaagaccga
agaggagggagaatattgaaacccaagcgccaaagagatgatggggagaacaggaatgaa
gcggggtcctctggagacatgagagctgccagcatgtggtcaaaccctctcttgattaag
caccctaagaagagcagccctgccttatccctgacagcagatcagatggtcagtgccttg
ttggaggctgagccccccctactctattctgagtatgattcaaccagacccttcagtgag
gcttcgatgatgggcttgctaaccaacctcgcagacagggagctggttcacatgatcaac
tgggcaaagagggtaccaggctttgtggatttgaccctccacgaccaggttcaccttttg
gaatgtgcctggctggagatcctgatgatcggtctcgtctggcgctccatggagcaccca
gggaagctcctgtttgctcccaacttgctcctggacaggaaccaggggaaatgtgtggag
ggcatggtggagatctttgacatgttactagctacgtcatctcggttccgtatgattaat
ctccagggagaggagtttgtgtgcctcaaatccatcattttacttaattctggagtatac
acatttctgtccagcactctgaagtctctggaagagaaggaccatatccaccgagtcctg
gacaagatcatagacaccttgatccatctgatggccaaagcaggcctgaccctgcagcag
cagcaccggcgcctggcccaactcctcctcatcctgtcccacatcaggcacatgagcaac
aaaggcatggagcatctgtacagcatgaagtgcaagaacgtggtgcccctctacgacctg
ctgctggagatgctggacgcccaccgaatgcgcagcgcgaccaaccgcgggggcaccccg
atggcggagacgcacccgagccacatggccgccccggcccccacctcgtcacattccttg
caaacgtattacatcagcggggaggcggagagtttccccggcacaatctga

DBGET integrated database retrieval system