KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509347
Entry
107509347         CDS       T06036                                 

Definition
(RefSeq) insulin-like growth factor 1 receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04066  HIF-1 signaling pathway
ray04068  FoxO signaling pathway
ray04114  Oocyte meiosis
ray04140  Autophagy - animal
ray04144  Endocytosis
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04510  Focal adhesion
ray04520  Adherens junction
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04730  Long-term depression
ray04913  Ovarian steroidogenesis
ray04914  Progesterone-mediated oocyte maturation
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05205  Proteoglycans in cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05218  Melanoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107509347
   04014 Ras signaling pathway
    107509347
   04015 Rap1 signaling pathway
    107509347
   04066 HIF-1 signaling pathway
    107509347
   04068 FoxO signaling pathway
    107509347
   04151 PI3K-Akt signaling pathway
    107509347
   04152 AMPK signaling pathway
    107509347
   04150 mTOR signaling pathway
    107509347
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107509347
   04140 Autophagy - animal
    107509347
  09143 Cell growth and death
   04114 Oocyte meiosis
    107509347
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107509347
   04520 Adherens junction
    107509347
   04550 Signaling pathways regulating pluripotency of stem cells
    107509347
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    107509347
   04914 Progesterone-mediated oocyte maturation
    107509347
  09156 Nervous system
   04730 Long-term depression
    107509347
  09149 Aging
   04211 Longevity regulating pathway
    107509347
   04213 Longevity regulating pathway - multiple species
    107509347
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107509347
   05202 Transcriptional misregulation in cancer
    107509347
   05205 Proteoglycans in cancer
    107509347
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107509347
   05214 Glioma
    107509347
   05218 Melanoma
    107509347
   05215 Prostate cancer
    107509347
   05224 Breast cancer
    107509347
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107509347
   01522 Endocrine resistance
    107509347
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107509347
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ray04090]
    107509347
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107509347
Protein kinases [BR:ray01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   107509347
CD molecules [BR:ray04090]
 Proteins
  107509347
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Furin-like Recep_L_domain fn3 Kinase-like DUF4476 B2
Other DBs
NCBI-GeneID: 107509347
NCBI-ProteinID: XP_015997290
LinkDB
Position
Unknown
AA seq 1130 aa
MNPNAACDATGLRDAAGAHLARAAERAVCPSACGKRACTEDNECCHPECLGGCSAPDDDA
ACVACRHYYFSGVCVTSCPPNTYRFEGWRCVDRDFCANIPNADGNDVEGFVIHDGECMQE
CPSGFIRNGSQSMFCIPCEGPCPKVCEEDKKTKTIDSVTSAQMLQGCTIFRGNLLINIRR
GNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRQILGEEQLEGNYSFYVLDNQ
NLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQGKGDINTRNNGERA
SCESDVLHFTSTTTWKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDGQDACGS
NSWNMVDVDLPSNKDIEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEILYIRT
NASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRHNYCSKD
KIPVRKYADGTFEIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRKVFENFL
HNSIFVPRPERKRRDVSQVANTTMSSRGRNSTADAYNGTDLDEPESEFPFYESRVDNKER
TVISNLQPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPAPATY
ENFTHLVIALPVAILLIVAGLVIMLYVFHRKRNSNRLGNGVLYASVNPEYFSAADVYVPD
EWEVARDKITMNRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNE
ASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSMRPEVEAHRVGAGEVTH
GTCHSKRAFQRSKRRRVAKKTENNVVLIPPSLSKMIQMAGEIADGMAYLNANKFVHRDLA
ARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWS
FGVVLWEIATLAEQPYQGFSNEQVLRFVMEGGLLDKPDNCPDIMFELMRMCWQYNPKMRP
SFLEIIGSIKDEMEPGFQEVSFYYSDENKPPDMEELDLEPENMESIPLDPSASSLSLPLP
DRLSGHRMENGPGPGMLVLRASFDDRQPYAHMNGGRKNERPLPLPQSSTC
NT seq 3393 nt   +upstreamnt  +downstreamnt
atgaaccccaacgcggcctgcgatgccaccggcctgcgggatgcggccggcgcgcacctg
gcgcgggctgcagagcgcgcggtgtgcccgagcgcgtgcgggaagcgggcgtgcaccgag
gacaacgagtgctgccaccccgagtgcctgggcggctgcagcgcgcccgacgacgacgcg
gcctgcgtggcctgtcgccactactacttctccggcgtgtgcgtgacctcctgcccgccc
aacacctaccgcttcgagggctggcgctgcgtggaccgcgacttctgcgccaacatcccc
aacgccgacggcaacgacgtggagggcttcgtcatccacgacggcgagtgcatgcaagag
tgcccctcgggcttcatccgcaacggcagccagagcatgttctgcatcccttgcgaagga
ccttgccccaaagtctgtgaggaagataagaaaacgaagaccattgattcggttacttct
gctcagatgctccaaggatgcaccatattcaggggcaatttgctcattaatattcgaaga
ggcaataacattgcctcggagctggagaacttcatggggcttatcgaggtggtgacgggc
tacgtgaagatccgccactcccacgccttggtgtccttgtccttcctgaaaaaccttcgc
cagatcctaggagaggagcagctggaggggaactactccttctacgtcctcgacaaccag
aacctgcagcagctgtgggactgggaccaccggaacctcaccatcaaggccgggaagatg
tacttcgccttcaaccccaagctgtgcgtctccgagatctaccgcatggaggaggtgacc
gggaccaaaggccgccagggcaaaggggacataaacaccaggaacaacggagagagagcc
tcctgtgagagcgacgtcctgcacttcacctccaccaccacgtggaagaaccgcatcatc
atcacatggcaccggtaccggccgccggactacagggacctcatcagcttcaccgtctac
tacaaggaagcaccctttaaaaacgtgacggaatatgatgggcaggacgcctgcggctcc
aacagctggaacatggtggatgtggacctgccttccaacaaggacatcgagcccggcatc
ctgctgcacggcctgaagccctggacgcagtacgccgtgtacgtcaaggccgtgaccctg
accatggtggagaacgaccacatccgcggggccaagagtgaaatcctgtacatccgcacg
aacgcgtcagttccttccattcccctggacgtcctgtccgcctcgaactcctcttcccag
ctgatcgtgaagtggaacccgccctccctgcccaacggcaacctgagctactacattgtg
aggtggcagcgacagcctcaggacggctacctgtaccggcacaattactgctccaaagac
aaaatccccgtcaggaagtacgccgacggcaccttcgagatcgaggaggtgacggagaac
cccaagaccgaggtgtgcggtggcgagaaggggccttgctgcgcgtgccccaaaaccgaa
gccgagaagcaggcggagaaggaggaggccgagtaccgcaaagtgttcgagaacttcctg
cacaactccatcttcgtgcccagacccgagcggaagcggagagacgtctcgcaggtggcc
aacaccaccatgtccagccgaggcaggaacagcacggcggacgcctacaacggcacggac
ctggacgagccggagtccgagttccctttctacgagagcagagtggacaacaaggagagg
acggtcatctccaacctgcagcccttcactctgtaccgcatcgacatccacagctgcaac
cacgaggcggagaagctgggctgcagcgcctccaacttcgtgtttgcgaggaccatgcct
gcagaaggagcagatgacattcctgggccggtgacctgggagccagccccagcgacctat
gaaaatttcacgcatctggtgatcgccctgcccgttgccatcctgctgatagtggcgggg
ctggtgataatgttgtatgtcttccaccggaaaagaaacagtaacagactgggcaatgga
gtgctgtatgcatctgttaaccctgaatacttcagcgcggctgacgtgtacgtgcccgac
gagtgggaggtggcccgcgacaagatcaccatgaaccgggagctgggccagggctccttc
gggatggtgtacgagggcgtggccaagggcgtcgtcaaggacgagcccgaaaccagagtg
gccattaaaacggtgaacgaggcggcgagcatgcgcgagaggatcgagtttctgaacgag
gcttcggtgatgaaggagttcaactgtcaccatgtggtgcggctgctgggtgtggtgtcc
cagggccagccgacgctggtcatcatggaactgatgacccggggcgatctcaagagttat
ctccggtccatgaggcctgaagtggaggcccacagggttggagctggagaggtgacacat
gggacctgtcacagcaagagggcttttcagcgttctaagagacgccgtgtggccaagaaa
actgagaataatgtggtgctcatccctccaagcctgagcaagatgatccagatggcggga
gagatcgcggacggcatggcgtacctcaacgccaacaagttcgtgcacagggacctggcc
gcccgcaactgcatggtggccgaggatttcaccgtcaaaatcggagatttcggaatgacc
agagacatctacgagaccgactattaccggaagggagggaaaggcctgctgcccgtgcgc
tggatgtcccccgagtccctgaaggacggcgtcttcaccactcactctgatgtctggtcc
ttcggcgtcgtcctctgggagatcgccacgctggccgagcagccgtaccagggattctcc
aacgaacaggtcctgcgctttgtcatggagggcggcctgctggacaaaccggacaactgc
cccgacataatgttcgagctgatgcgcatgtgctggcagtacaaccccaagatgcggcct
tccttcctggagatcatcggcagcatcaaggacgagatggagcccggcttccaggaggtg
tccttctactacagcgacgagaacaagccgcccgacatggaggagctggacctggagccg
gagaacatggagagcatcccgctggacccctcggcctcgtcgctgtccctgccgctgccc
gacagactctcaggacaccggatggagaacggcccgggcccgggcatgctggtcctccgg
gccagcttcgacgacaggcagccttacgcgcacatgaatgggggacgcaagaatgagagg
ccactgcctctcccccagtcctccacctgctga

DBGET integrated database retrieval system