KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509357
Entry
107509357         CDS       T06036                                 

Gene name
ELK1
Definition
(RefSeq) ETS domain-containing protein Elk-1
  KO
K04375  ETS domain-containing protein Elk-1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04510  Focal adhesion
ray04910  Insulin signaling pathway
ray04912  GnRH signaling pathway
ray04921  Oxytocin signaling pathway
ray05140  Leishmaniasis
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05213  Endometrial cancer
ray05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107509357 (ELK1)
   04012 ErbB signaling pathway
    107509357 (ELK1)
   04014 Ras signaling pathway
    107509357 (ELK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107509357 (ELK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107509357 (ELK1)
   04912 GnRH signaling pathway
    107509357 (ELK1)
   04921 Oxytocin signaling pathway
    107509357 (ELK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107509357 (ELK1)
   05205 Proteoglycans in cancer
    107509357 (ELK1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107509357 (ELK1)
   05213 Endometrial cancer
    107509357 (ELK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107509357 (ELK1)
   05161 Hepatitis B
    107509357 (ELK1)
   05163 Human cytomegalovirus infection
    107509357 (ELK1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    107509357 (ELK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107509357 (ELK1)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    107509357 (ELK1)
SSDB
Motif
Pfam: Ets
Other DBs
NCBI-GeneID: 107509357
NCBI-ProteinID: XP_015997312
LinkDB
Position
Unknown
AA seq 436 aa
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL
SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSITSTMANMAPTAIH
VVPGDTASGKPGTPKGTGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPQPQPPLQPR
PISVLPNTAPAGAAVPHSGSKSTSPSPLEACLETEEAGLPLQVILTPPEAPNPKSEELKV
EPGLGRPLPPEVKVEGPKEELDAAAGGEAGFVPEAVKAEPEVPPAEGLPARLPTVMEGAV
PVGGLGASTASSTEIAQPQKGRKPRDLELPLSPSLLSGPGPERTPGSGTGSSMQAPGPAL
TPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISV
DGLSTPVVLSPGPQKP
NT seq 1311 nt   +upstreamnt  +downstreamnt
atggacccctctgtgacgctgtggcagtttctgctgcagctgctgagagaacaaggcaat
ggccacatcatctcctggacttcacgggatggtggtgagttcaagctggtggatgctgag
gaggtggcccggttgtgggggctgcgcaagaacaagaccaacatgaattatgacaagctc
agccgggctttgcggtactactatgataagaacatcatccgcaaagtgagtggccagaag
ttcgtctacaagtttgtgtcctatcctgaggttgcagggtgctccactgaggactgccca
ccccagcccgaggtgtctatcacttccactatggcaaatatggcccccactgctatacat
gttgtccctggggacactgcctctgggaagccaggcacacccaagggtacaggaatggca
ggcccaggtggcttggcgcgaagcagccggaatgagtacatgcgctcgggcctctattcc
accttcaccatccagtccctgcagccgcagccgcagccacagccacccctgcagccacgg
cccatttcagtgcttcccaacactgccccagcaggagcagcagtgccccactcagggagc
aagagcaccagtcctagccccttggaggcctgcctggagactgaggaggctggcctgccc
ctccaggtcattctgaccccgccagaggccccgaaccctaagtcagaagagctgaaggtg
gagccggggttgggccggccactgcccccagaagtgaaagtagaagggcccaaggaggag
ttggacgcggcagccggtggggaggcagggtttgtgccggaagctgttaaagccgagccg
gaagtccctcctgcggagggcctgccagcccgacttcccacagttatggagggtgcagtg
ccggtgggtggcctcggggcttccacagcttccagcacggagatcgcccagcctcagaag
ggccggaagccccgggacctggagcttccactcagccctagcctgctgagtgggccagga
cccgaacggactccaggatcaggaactggctccagtatgcaggcaccggggccagcgtta
acgccatccctgctacctacgcacacattgactccggtgctgctgacgcccagctcgctg
ccccccagcattcacttctggagcaccctgagtcctattgcaccccgtagccctgccaag
ctctccttccagtttccatccagtggcagcgcccaggtgcacatcccttccatcagcgtg
gatggcctgtcaacccccgtggtgctctccccagggccccagaagccatga

DBGET integrated database retrieval system