KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509491
Entry
107509491         CDS       T06036                                 

Gene name
PLD2
Definition
(RefSeq) phospholipase D2 isoform X1
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00564  Glycerophospholipid metabolism
ray00565  Ether lipid metabolism
ray01100  Metabolic pathways
ray04014  Ras signaling pathway
ray04024  cAMP signaling pathway
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04144  Endocytosis
ray04666  Fc gamma R-mediated phagocytosis
ray04724  Glutamatergic synapse
ray04912  GnRH signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray05200  Pathways in cancer
ray05212  Pancreatic cancer
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107509491 (PLD2)
   00565 Ether lipid metabolism
    107509491 (PLD2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107509491 (PLD2)
   04072 Phospholipase D signaling pathway
    107509491 (PLD2)
   04071 Sphingolipid signaling pathway
    107509491 (PLD2)
   04024 cAMP signaling pathway
    107509491 (PLD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107509491 (PLD2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    107509491 (PLD2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107509491 (PLD2)
   04928 Parathyroid hormone synthesis, secretion and action
    107509491 (PLD2)
  09156 Nervous system
   04724 Glutamatergic synapse
    107509491 (PLD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107509491 (PLD2)
   05231 Choline metabolism in cancer
    107509491 (PLD2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107509491 (PLD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107509491 (PLD2)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     107509491 (PLD2)
Membrane trafficking [BR:ray04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107509491 (PLD2)
 Endosome - Golgi transport
  Others
   Others
    107509491 (PLD2)
SSDB
Motif
Pfam: PX PLDc_2 PLDc PH PH_2
Other DBs
NCBI-GeneID: 107509491
NCBI-ProteinID: XP_015997519
LinkDB
Position
Unknown
AA seq 1012 aa
MESARHTEWAAQLRGTEDDPPPPPGPRAERWTAGRAEGGGGGTGQTRIPRRMTASPESLL
FSGGDLDSSQLQMEPDEVDTLREGEDPGTQEGWPSGRGGGGAETSCCLYSSTFLLADRMH
PFLAIYDLRPLKMHPLVFAPGVPVTAQVVGTERYTSGSKVGTCTLYSVRLTHGDFTWTTK
KKFRHFQELHRDLLRHKVLMSLLPLARFAVPYPPAQEAADREMPSLPRAGPDGSTRRASS
KQKYLENYLNRLLTMSFYRNYHAMTEFLEVSQLSFIPDLGSKGLEGVIRKRSGGHRVPGL
TCCGRDQVCYRWSKRWLVVKDSFLLYMCLETGAISFVQLFDPGFEVQVGKRSTEARYGVR
IDTSHRSLILKCSSYRQARWWGQEITELAQGPGRDFLQLHRHDSYAPPRPGTLARWFVNG
AGYFAAVADAILRAQEEIFITDWWLSPEIYLKRPAHSNDWRLDIMLKKKAEDGVRVSILL
FKEVELALGINSGYSKRVLMLLHPNIKVMRHPDQVTLWAHHEKLLVVDQVVAFLGGLDLA
YGRWDDLHYRLTDLGESSELDAPQPPKPCSDSPATPDLSHNQLFWLGKDYSNLITKDWVQ
LDRPFEDFIDRETTPRMPWRDVGVVVHGPPARDLARHFIQRWNFTKTTKAKYKTPVYPYL
LPKSTSTSNQLPFVLPGGQCATVQVLRSVDRWSAGTLENSILNAYLNTIRESQHYLYIEN
QFFISCSDGRTVLNKVGDEIVDRILKAHRQGQCFRVYVLLPLLPGFEGDISTGGGNSIQA
ILHFTYRTLCRGEYSILHRLKAAMGTAWRDYMSICGLRTHGELGGHLVSELIYIHSKMLI
ADDRTVIIGSANINDRSLLGKRDSELALLIEDTELEPSLMDGVEYQAGRFALSLRKHCFS
VVLGADARPDLDLRDPVSDDFFQLWQETAENNANIYEQIFRCLPSNATRSLRALREYVTV
EPLAMVSPPLARSELTQVQGHLVHFPLKFLEDESLLPTLGSKEGMMPLEVWT
NT seq 3039 nt   +upstreamnt  +downstreamnt
atggagtccgccagacacacggagtgggccgcgcaacttcgtggcacagaagacgacccc
ccacccccacccgggcccagggctgagcgctggaccgcagggcgggccgagggaggcggg
ggcgggacaggacagacgagaatcccgcggaggatgacagcgagcccagagagcctctta
ttctctgggggcgacctggactccagccaattacagatggagcccgatgaggtggacact
ctgagggagggagaggacccaggtacacaggaaggttggccctcagggagaggaggagga
ggggctgagacctcctgctgtctgtactcttccactttccttctagctgaccggatgcat
ccctttctggccatctatgaccttcggcctctgaaaatgcaccccttggtgttcgcccct
ggggttcctgtcacagcccaggttgtgggcactgagagatacaccagtggatccaaggtg
ggaacctgcactctgtattctgtccgcttgactcatggtgactttacctggacaaccaag
aagaagttccgtcattttcaggagctgcatcgggacctcctgagacacaaagtcttgatg
agtctgctccctttagctcgctttgctgtaccctatcctccagcccaagaggcagccgat
agagagatgccctctctaccccgagcaggtcctgatggctccactagacgtgcatccagc
aaacagaaatacctggagaattacctcaaccgcctcctgaccatgtctttctaccgcaac
tatcatgccatgacagagttcctagaagtcagtcagctgtcatttatcccagaccttgga
tccaaaggactagaaggggtgatccggaagcgctcaggtggccaccgtgttcctggtctc
acctgctgtggccgagaccaagtttgctatcgctggtccaagaggtggctggtggtgaag
gactccttcctgctgtacatgtgcctcgagactggcgccatctcatttgttcagcttttt
gaccctgggttcgaagtacaggtggggaaaaggagcacagaggcacggtatggggtccga
atcgacacttcccacaggtccctgattctcaagtgcagtagctaccggcaggcacgatgg
tggggccaggaaatcactgagctggcccagggcccgggcagagacttcctgcagctgcac
aggcatgacagctatgctccgccccggcctggtactttggcccggtggtttgtgaatggg
gcaggttactttgctgctgtggcagatgccatcctgcgagctcaagaggagatttttatt
acagactggtggttgagtcctgagatttacctgaagcgtccggcccattcaaatgactgg
aggctggacattatgctcaagaagaaggcggaggatggtgtccgtgtgtccatactgctg
tttaaggaagtggagttggcattgggcatcaacagtggctatagcaagagggttctgatg
ttgctgcaccccaacataaaggtgatgcgccacccagaccaggtgacgttgtgggcccat
catgagaagctgctggtggtggaccaagtagtggccttcttgggggggctggacctcgcc
tatggccgctgggatgacctgcactaccgactgactgaccttggggaatcttctgaatta
gatgccccacagcctcccaaaccatgctcagactctccagccaccccagacttgtctcac
aaccaactcttctggctgggcaaggactacagcaatcttatcactaaggactgggtgcag
ctggatcggccttttgaggatttcattgacagggagaccacaccccggatgccatggcgg
gatgttggggtggttgtccatggcccacccgcccgggacctggcccgacacttcatccag
cgctggaacttcaccaagactaccaaggccaagtacaagacacctgtgtacccctacctg
ctgcccaagtccaccagtacctcaaaccagctccctttcgtactcccaggggggcagtgt
gccactgtgcaggtcttgcggtcagtagaccgttggtctgcagggactttggagaactcc
atcctcaatgcctacctgaacaccatcagggagagccagcactatctctacattgagaat
cagttcttcattagctgctcagatggacggacagttctgaacaaggtgggcgatgagatt
gtggacagaatcctgaaggcccacagacagggtcagtgcttccgagtctatgtgcttctg
cctctgcttcccggttttgagggtgacatatccacaggtggtggcaactctatccaggcc
attctgcacttcacttacaggaccctgtgtcgtggggaatattcaatcctacatcgcctc
aaagcagctatggggacagcatggcgggactatatgtccatctgtgggctccgcacacat
ggagagctgggtgggcacctggtctcagagctcatctatatccatagcaagatgctcatt
gcagatgaccggacagtcatcattggctctgcaaacatcaatgaccggagcctgctgggg
aagagggacagtgagctggccctgttgatcgaggacacagagttggagccatccctcatg
gatggtgtggaatatcaggcgggcaggtttgccttgagtttgcggaagcactgcttcagt
gtggttcttggggcagatgctcggccagacctggatctccgagaccctgtctctgatgac
ttcttccagttgtggcaagaaacagctgagaacaatgccaatatctatgagcagatcttc
cgctgcctgccatccaacgccacacgttccttgcgggcactccgggaatacgtgactgtg
gagcccctagccatggtcagccctcccttggcccggtctgagctcacccaggttcagggc
cacctggtccactttcccctcaagttcttggaggatgagtctttgctacccaccctgggt
agtaaggagggtatgatgcccctagaagtatggacatag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515926
Entry
107515926         CDS       T06036                                 

Gene name
PLD1
Definition
(RefSeq) phospholipase D1
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00564  Glycerophospholipid metabolism
ray00565  Ether lipid metabolism
ray01100  Metabolic pathways
ray04014  Ras signaling pathway
ray04024  cAMP signaling pathway
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04144  Endocytosis
ray04666  Fc gamma R-mediated phagocytosis
ray04724  Glutamatergic synapse
ray04912  GnRH signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray05200  Pathways in cancer
ray05212  Pancreatic cancer
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107515926 (PLD1)
   00565 Ether lipid metabolism
    107515926 (PLD1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107515926 (PLD1)
   04072 Phospholipase D signaling pathway
    107515926 (PLD1)
   04071 Sphingolipid signaling pathway
    107515926 (PLD1)
   04024 cAMP signaling pathway
    107515926 (PLD1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107515926 (PLD1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    107515926 (PLD1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107515926 (PLD1)
   04928 Parathyroid hormone synthesis, secretion and action
    107515926 (PLD1)
  09156 Nervous system
   04724 Glutamatergic synapse
    107515926 (PLD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107515926 (PLD1)
   05231 Choline metabolism in cancer
    107515926 (PLD1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107515926 (PLD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107515926 (PLD1)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     107515926 (PLD1)
Membrane trafficking [BR:ray04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107515926 (PLD1)
 Endosome - Golgi transport
  Others
   Others
    107515926 (PLD1)
SSDB
Motif
Pfam: PLDc_2 PLDc PX PH DUF3785
Other DBs
NCBI-GeneID: 107515926
NCBI-ProteinID: XP_016010715
LinkDB
Position
Unknown
AA seq 1033 aa
MSLKNEPSVNTSALKKIAADMSNLIEHLDTRELHFEGDELECDVAPGDPKIQEVYIPFSA
IYKTQGFKEPDIQTYLSGYPIKAQVLEVERFTSTTRVRSINLYTIELTHGEFKWQVKRKF
KHFQEFHRELLKYKAFIRIPIPTKRHTVRRQNVKEEPREMPSLPSSSENTIREEQFFGRR
KQLEDYLTKLLKMPMYRNYHATTEFLDISQLSFIHDLGPKGIEGMIMKRSGGHRIPGLNC
CGQGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFRIKVGRKETETKYGLRID
NLSRTLILKCNSYRHARWWAGAIEEFIQKHGANFLKDHRFGSYAAVQENSLAKWYVNAKG
YFEDVANAMEEAEEEIFITDWWLSPEIFLKRPVVEGNRWRLDYVLKRKAQQGVRIFIMLY
KEVELALGINSEYSKRTLMRLHPNIKVMRHPDHVSSSVYLWAHHEKLVIIDQSVAFVGGI
DLAYGRWDDHEHRLTDVGSVKRVTTGPSLSSLTVSGMESLSLKEKNESTKNLPMVKSGND
TDSKLKGIGKSRKFSKFSLYRQLHRHHLHNADSISSIESASKTGSIRSLQTGIGELHGET
RFWHGKDYCNFVFKDWVQLDKPFADFIDRHSTPRMPWHDIASVVHGKAARDVARHFIQRW
NFTKIMKSKYRSLSYPFLLPKSQTTAHELKYQVPGSIHANVQLLRSAADWSAGIKYCEGS
IHTAYIHVIENSKHYIYIENQFFISCSDDKVVFNKIGDAIAQRILKAHRESKRYRVYVVI
PLLPGFEGDISTGGGNALQAIMHFNYRTMCRGENSILGQLKAEIGNRWINYISFCGLRTH
AELEGSLVTELIYVHSKLLIADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVM
DGEEYQAGRFAQGLRLQCFRVVLGYLSDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKV
FRCLPNDEVHNLIQLRDFITKPVLAKEDPSRAEEELKKIRGFLVQFPFYFLSEESLLPAV
GTKEAIVPMEVWT
NT seq 3102 nt   +upstreamnt  +downstreamnt
atgtcactgaaaaatgagccaagtgtaaatacctctgcactgaagaaaatcgctgctgac
atgagtaatttgatagaacacctggacactcgggagctccactttgagggagacgagttg
gaatgtgatgtggctcccggcgatcctaagatacaggaagtgtatattcctttctctgct
atttataagactcaaggatttaaggagcctgatatacagacgtacctctctggctatcct
ataaaagcccaagttctggaagtggagcgcttcacgtcgacgacaagggtacgaagcatc
aacctttacactattgaattgacacatggggaatttaaatggcaagttaaaaggaaattc
aagcactttcaagaatttcacagagagctgctcaagtacaaagcctttatccgaatcccc
attcccaccaaaagacacacagttagaagacagaatgtcaaagaagagcctcgagagatg
ccaagtttgcccagttcttctgaaaacacgataagagaagaacaattttttggtagaagg
aaacagctggaagattacttgacaaaattactaaaaatgcccatgtatagaaactatcat
gcaacaacagaattccttgatataagccagctgtctttcatccatgatttgggaccaaag
ggcatagaaggcatgataatgaaaagatccgggggacacaggataccaggcttgaattgc
tgtggtcagggaagagcctgctaccggtggtctaaaaggtggttgatagtgaaagactcc
tttttgctttatatgaaaccggacagtggtgctattgccttcgtcctgctggtggataaa
gaattcagaattaaggtggggaggaaggagacagagacgaaatatggactccgaattgat
aacctttcaaggacacttattttaaaatgcaacagctatagacatgctcggtggtgggca
ggggctatagaagaattcatccagaaacatggtgccaactttctcaaagatcatcgattt
gggtcatatgctgctgtccaagagaactctttagccaaatggtatgttaatgccaaagga
tattttgaagatgttgcaaatgcaatggaagaggcagaagaagaaatttttatcacagat
tggtggttgagtccagaaatctttctgaaacgcccagtggttgaaggaaatcgttggagg
ctggactacgttcttaaacgaaaagcacaacaaggtgtaaggatcttcattatgctctac
aaagaggtggaacttgctcttggaatcaacagtgaatacagcaagaggactttaatgcgt
ctacaccccaacataaaggtgatgaggcacccagaccatgtatcttccagcgtatatctg
tgggctcatcatgagaaacttgtcatcattgaccagtcagtggcctttgtgggcgggatc
gacctggcctatggaaggtgggatgaccatgagcacagactcacggacgtgggcagcgtg
aagcgtgtcaccacgggaccatctctgagttccctcacagtaagtgggatggaatcctta
agcctcaaagaaaaaaatgaatctactaaaaatctgcccatggtaaagagtggtaatgat
acagattcaaaactgaaaggaataggaaagtccagaaagttctccaaattcagcctgtat
cggcagctgcataggcaccacctgcacaacgcagacagcatcagcagcattgaaagcgcc
tccaaaacaggctccatccgcagtttacagacaggtataggagagctgcacggggaaacc
agattctggcatggaaaggactactgcaatttcgtcttcaaagactgggttcaacttgat
aaaccttttgctgatttcattgacaggcactccactccccggatgccgtggcatgacatt
gcctctgtggtgcacgggaaggccgctcgggacgtggcgcggcacttcatccagcgctgg
aacttcacgaagattatgaaatcaaaatatcgatctctttcttatccttttctgcttcca
aaatctcaaacaacagcccatgagttgaaatatcaagtgcctggatccatccatgctaat
gtacagttactccgctctgccgctgattggtctgctggtataaagtactgtgaaggctcc
atccacactgcttacatccatgtgatagagaacagcaagcactatatctatatagaaaac
caattttttataagctgctccgatgacaaggttgtgttcaataagataggtgatgccatt
gcccagaggatactgaaggctcacagggaaagcaagagataccgggtatatgttgtgata
ccacttctgccagggtttgaaggagacatttcaactggtggaggaaatgctctacaggca
ataatgcacttcaactacagaaccatgtgcagaggagaaaattccatccttggacagttg
aaagcagagattggcaatcggtggataaattacatatcattctgtggtcttcggacacat
gcagagcttgaaggaagcctggtcactgagcttatctacgtccacagcaagttactgatt
gctgatgacaacactgttattattggctctgccaacatcaatgaccgaagcatgctggga
aagcgtgatagtgaaatggctgtcattgtgcaggacacggagacagtcccttcggtaatg
gatggtgaagagtaccaagctggccggtttgcccaaggacttcggctgcagtgctttagg
gttgtccttggctatctttctgatccaagtgaggacattcaggatccagtgagtgacaaa
ttcttcaaggaggtgtgggtttcaacagcagctcgaaatgctacaatatatgacaaggtg
ttccggtgccttcccaatgatgaagtacacaatttaattcagctgagagactttataacc
aagcccgtattagcaaaggaagatcccagtagagctgaagaagaactgaaaaagatccgt
gggttcttggtgcaattccctttttatttcttgtctgaagaaagcctactgcctgctgtc
ggaaccaaagaagccatagtacccatggaggtttggacttaa

DBGET integrated database retrieval system