KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509496
Entry
107509496         CDS       T06036                                 

Gene name
ARRB2
Definition
(RefSeq) beta-arrestin-2 isoform X1
  KO
K04439  beta-arrestin
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04062  Chemokine signaling pathway
ray04144  Endocytosis
ray04340  Hedgehog signaling pathway
ray04728  Dopaminergic synapse
ray04740  Olfactory transduction
ray04926  Relaxin signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray04929  GnRH secretion
ray05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107509496 (ARRB2)
   04340 Hedgehog signaling pathway
    107509496 (ARRB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107509496 (ARRB2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107509496 (ARRB2)
  09152 Endocrine system
   04929 GnRH secretion
    107509496 (ARRB2)
   04926 Relaxin signaling pathway
    107509496 (ARRB2)
   04928 Parathyroid hormone synthesis, secretion and action
    107509496 (ARRB2)
  09156 Nervous system
   04728 Dopaminergic synapse
    107509496 (ARRB2)
  09157 Sensory system
   04740 Olfactory transduction
    107509496 (ARRB2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107509496 (ARRB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107509496 (ARRB2)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    107509496 (ARRB2)
SSDB
Motif
Pfam: Arrestin_N Arrestin_C SCA7
Other DBs
NCBI-GeneID: 107509496
NCBI-ProteinID: XP_015997538
LinkDB
Position
Unknown
AA seq 409 aa
MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTC
AFRYGREDLDVLGLSFRKDLFIATYQAFPPMPNPPRPPTRLQDRLLRKLGQHAHPFFFTI
PQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPG
PQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYA
DICLFSTAQYKCPVAQIEQDDQVSPSSTFCKVYTVTPLLSDNREKRGLALDGKLKHEDTN
LASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHITLPRPQS
AAPETDAPVDTNLIEFDTNYATDDDIVFEDFARLRLKGIKDEDYDDQFC
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgggggagaaacccgggaccagggtcttcaagaagtcgagccctaactgcaagctcact
gtgtacttgggcaagcgggactttgtagatcacctggacaaagtggatcctgtagatggt
gtggtgcttgtggaccctgactacttgaaggaccgcaaagtgtttgtgaccctcacctgc
gccttccgatatggccgcgaagacctggacgtgctgggcttgtccttccgcaaagacctg
ttcatcgccacctaccaggccttccccccaatgcccaatccaccccggccccccacccgc
ctgcaggatcggctgctgaggaagctgggccagcatgcccaccccttttttttcacaata
ccccagaatctgccctgctccgtgaccctgcagccaggcccagaggacactgggaaggcc
tgcggggtagactttgagattcgagccttctgtgccaaatcactagaagaaaaaagccac
aaaaggaactctgttcggctggtaattcgaaaagttcagtttgccccagagaaacccggc
ccccagccttcagctgaaaccacacgccacttcctcatgtctgaccggtccctgcacctt
gaggcttccttggacaaggagttgtattaccacggggagcccctcaacgtcaatgtccat
gtcaccaacaactccaccaagaccgtcaagaagatcaaagtctctgtgagacagtatgcc
gacatctgcctcttcagcactgctcagtacaagtgtcccgtggctcagattgaacaagat
gatcaggtatctcccagttccacgttttgcaaggtatacaccgtaacaccgctgctcagc
gacaaccgggagaagcgtggtcttgccctggatggaaagctcaagcatgaggacaccaac
ctggcttctagcaccattgtgaaagagggtgccaacaaggaggtgctggggatcctagtg
tcgtacagggtcaaggtgaagctggtggtgtctcgtggtggggatgtctccgtggagctg
ccttttgttcttatgcaccccaagccccatgaccacatcaccctccctagaccccaatca
gctgctcctgaaacagatgcgcccgtggataccaacctcattgaatttgataccaactat
gccacagatgatgacattgtgtttgaggactttgcccgacttcggctgaaggggataaag
gatgaagactacgatgaccagttctgctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519169
Entry
107519169         CDS       T06036                                 

Gene name
ARRB1
Definition
(RefSeq) beta-arrestin-1 isoform X1
  KO
K04439  beta-arrestin
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04062  Chemokine signaling pathway
ray04144  Endocytosis
ray04340  Hedgehog signaling pathway
ray04728  Dopaminergic synapse
ray04740  Olfactory transduction
ray04926  Relaxin signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray04929  GnRH secretion
ray05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107519169 (ARRB1)
   04340 Hedgehog signaling pathway
    107519169 (ARRB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107519169 (ARRB1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107519169 (ARRB1)
  09152 Endocrine system
   04929 GnRH secretion
    107519169 (ARRB1)
   04926 Relaxin signaling pathway
    107519169 (ARRB1)
   04928 Parathyroid hormone synthesis, secretion and action
    107519169 (ARRB1)
  09156 Nervous system
   04728 Dopaminergic synapse
    107519169 (ARRB1)
  09157 Sensory system
   04740 Olfactory transduction
    107519169 (ARRB1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107519169 (ARRB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107519169 (ARRB1)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    107519169 (ARRB1)
SSDB
Motif
Pfam: Arrestin_N Arrestin_C AP3B1_C
Other DBs
NCBI-GeneID: 107519169
NCBI-ProteinID: XP_016017015
LinkDB
Position
Unknown
AA seq 526 aa
MWTCMFIELSPYLVFTLFPVFTLANNAEVINFETVQSLPEGRILEVAEVPGSAVTFLPHP
CTSFLLLRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRGPSSVPT
ASTVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLG
EHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIR
KVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVK
KIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLAL
DGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPF
TLMHPKPKEEPPHREVPENEAPVDTNLIELDTNQRPSHHWKVARGAGPGPTSRTTSRAKQ
LSRSSSKSIHPSLVPWEIYGMWGLKSLHEDTLCSWLNSGDRGPGWD
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgtggacgtgcatgtttattgaactatccccttatttggtatttacattatttccagtt
tttactcttgcaaataatgctgaagtgattaactttgaaactgtccagtcacttcctgag
ggcagaattctggaagttgcagaagtcccaggttcagctgtcaccttccttcctcacccc
tgcacatcttttttactcctaagggtgttcaagaaggcaagcccgaatgggaagcttacc
gtctatctgggaaagcgagacttcgtggaccacatcgacctcgtggaccctgtggatggt
gtggtcctggtggatcctgagtatctcaaggagaggagaggcccttcctcagtgcccact
gcttccacagtctatgtgacactgacctgcgccttccgctatggtcgggaggacctggat
gtcctgggcctgacctttcgcaaggacctgtttgtggccaacgtgcagtccttcccaccg
gcccctgaggacaagaagcccctgacacggctgcaggaacgcctcatcaagaagctgggc
gagcacgcctaccctttcacctttgagatccctccaaaccttccatgctctgtgacgctg
cagccggggcctgaagacacagggaaggcctgtggtgtggactatgaagtcaaagccttc
tgtgcggagaacctggaggagaagatccacaagcggaattctgtgcgcctggttatcagg
aaggttcagtatgccccagagaggcctggcccccagcccacagctgagaccaccaggcag
ttcctcatgtcagacaagcctttgcatctagaggcctccctggataaggagatctattac
catggagaacccatcagcgtcaatgttcatgtcaccaacaacaccaacaagacagtgaag
aagatcaagatctcggtgcgccagtatgcggacatctgccttttcaacacagcccagtat
aagtgccctgtggccatggaagaggctgatgacacagtggcacccagctcaacgttctgc
aaggtctatacgttgacccccttcctggccaacaatcgagaaaagcggggcctcgccctg
gatgggaagctcaagcacgaagacacgaatttggcttccagcaccctgttgagggaagga
gccaacagagagatcctgggcatcattgtttcctacaaagtgaaagtgaagctggtggta
tcgcggggtggcctgttgggagatcttgcgtccagtgatgtggccgtggaactgcccttc
accctaatgcaccccaagcccaaagaagaacccccacatcgggaagttccagagaacgag
gcgccagtggataccaatctcatagaacttgacacaaatcaaaggccatcgcatcactgg
aaagtggccagaggggcaggacctgggccgacatcacgaaccacctccagggccaagcag
ctttctcgctccagctccaaatccatccacccttcccttgtcccctgggagatatatggg
atgtggggtctcaagtcactccatgaggacaccctatgcagctggctgaattctggggac
aggggacccgggtgggactaa

DBGET integrated database retrieval system