KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509544
Entry
107509544         CDS       T06036                                 

Gene name
BMP4
Definition
(RefSeq) bone morphogenetic protein 4
  KO
K04662  bone morphogenetic protein 4
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04350  TGF-beta signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04919  Thyroid hormone signaling pathway
ray05200  Pathways in cancer
ray05217  Basal cell carcinoma
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107509544 (BMP4)
   04390 Hippo signaling pathway
    107509544 (BMP4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107509544 (BMP4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107509544 (BMP4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107509544 (BMP4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107509544 (BMP4)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    107509544 (BMP4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107509544 (BMP4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107509544 (BMP4)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107509544 (BMP4)
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   107509544 (BMP4)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Morphogens
   107509544 (BMP4)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 107509544
NCBI-ProteinID: XP_015997634
LinkDB
Position
Unknown
AA seq 409 aa
MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEAT
LLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEEQIHSIALEYPERPASRANTVRS
FHHEEHLENIPGTSENSAFRFLFNLSSIPENEVISSAELRLFREQVNQGPDWEQGFHRIN
IYEVMKPPAELVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAVEVT
HLHQTRTHQGQHVRISRSLPQGSEDWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHPQ
RARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQT
LVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgattcctggtaaccgaatgctgatggtcgttttattatgccaagtcctgctaggaggc
gcgagccatgctagtttgatacctgagacggggaagaaaaaagtcgccgagattcagggc
cacgcgggaggacgccgctcagggcagagccatgagctcctgcgggacttcgaggctaca
cttctgcagatgttcgggctgcgccgccgcccgcagcctagcaagagcgcagtcatcccg
gattacatgcgggatctttaccggctccagtctggggaggaggaggaggaagagcagatc
cacagcatcgctctggagtatcctgagcgccccgccagtcgggccaataccgtgaggagc
ttccaccacgaagaacatctggagaacatcccagggaccagcgaaaactctgcttttcgt
ttcctctttaacctcagcagcatcccagagaacgaggtgatctcttctgcagagcttcga
ctcttccgggagcaggtgaaccagggccctgattgggagcagggtttccaccgaataaac
atttatgaggttatgaagcccccagcagaactggtgcctgggcacctcatcacacgacta
ctggacacaagactggtccaccacaatgtgacacggtgggaaacttttgatgtgagccct
gcggtccttcgctggacccgggagaaacagccgaactacggactggccgttgaggtgact
cacctccatcagacacggacccaccagggccagcatgtcaggattagccgatcgttacct
caagggagtgaggattgggcccagctccggcccctcctggttacctttggccatgatggc
cggggacatgccttgacccgaaggcggagggccaagcgtagccccaagcatcacccacag
cgagcccggaagaagaataagaactgtcggcgccactcgctctatgtggacttcagcgat
gtgggctggaatgactggattgtggccccaccaggctaccaggccttctactgccacggg
gactgcccctttccactggctgaccacctcaactcaaccaatcatgccattgtgcagacc
ctggtcaattctgtcaattccagtatccccaaagcctgttgtgttcccaccgaactaagc
gccatctccatgctgtacctggatgagtatgacaaggtggtactgaaaaattatcaggag
atggtagtagagggatgtgggtgccgctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511521
Entry
107511521         CDS       T06036                                 

Gene name
BMP2
Definition
(RefSeq) bone morphogenetic protein 2
  KO
K21283  bone morphogenetic protein 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04350  TGF-beta signaling pathway
ray04390  Hippo signaling pathway
ray05200  Pathways in cancer
ray05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107511521 (BMP2)
   04390 Hippo signaling pathway
    107511521 (BMP2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107511521 (BMP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107511521 (BMP2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    107511521 (BMP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107511521 (BMP2)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107511521 (BMP2)
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   107511521 (BMP2)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Morphogens
   107511521 (BMP2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 107511521
NCBI-ProteinID: XP_016001866
LinkDB
Position
Unknown
AA seq 395 aa
MVAGTRCLLALLLPQVLLGGAAGLIPELGRRKFAASPGRSSSQPSDDILSEFELRLLSMF
GLKQRPTPSRDAVVPPYMLDLYRRHSGQPGVPAPDHRLERAASLANTVRSFHHEESLEEL
PEMSGKTTRRFFFNLTSIPTEEFITSAELQVFREQMQENLENNSSFHHRINIYEIIKPAA
ANSKFPVTRLLDTRLVNQNASRWESFDVTPAVMRWTAQGLANHGFVVEVAHLEENHGVSK
RHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHPL
YVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNAKIPKACC
VPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggtggccgggacccgctgtcttctagcgttgctgcttccccaggtcctcctgggcggc
gcggccggcctcattcctgagctgggccggagaaagttcgcggcgtcacctggccgctcc
tcgtcccagccctcggatgacatcctgagcgagttcgagttgcggttgctcagcatgttc
ggcttgaagcagagacccacccccagcagggacgccgtggtgcccccctacatgctggac
ctgtaccgccggcactcgggccagccgggtgtgcccgccccggaccaccgcctggagaga
gcagccagccttgccaacactgtgcgcagcttccaccacgaagaatctttggaagaactg
ccagaaatgagtggaaaaacaacccggcgattcttctttaatttaacttctatccccacc
gaggagtttatcacctcagcagaacttcaggtttttcgggaacagatgcaggaaaatttg
gaaaacaatagcagtttccatcaccgaattaatatttatgaaattataaaacctgcagca
gccaactcgaagttccccgtgaccagacttttggacaccaggttggtgaatcagaatgca
agcaggtgggagagtttcgatgtcacccctgctgtgatgagatggactgcacagggactc
gccaaccacggatttgtggtggaagtggcccacttagaggagaaccacggtgtctccaag
agacacgttaggattagcaggtctttgcaccaagacgagcacagctggtcacagataagg
ccactgctagtaacttttggccatgatggaaaaggacatcctctgcacaagagagaaaag
cgtcaagcgaaacataaacagcgcaaacgccttaagtccagctgtaagagacaccctttg
tacgtggacttcagtgacgtgggatggaatgactggatcgtagccccgccagggtatcat
gccttttattgccatggggaatgcccttttcccctggctgaccacctgaactccactaat
cacgccattgttcagacgttggtcaactcagttaacgctaagattcctaaggcgtgctgt
gtcccaacggaactgagtgctatctccatgctgtaccttgacgaaaatgaaaaggttgta
ttaaagaattatcaggacatggttgtggagggttgtgggtgtcgttag

DBGET integrated database retrieval system