KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509617
Entry
107509617         CDS       T06036                                 

Gene name
NCK2
Definition
(RefSeq) cytoplasmic protein NCK2
  KO
K19862  NCK adaptor protein 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04012  ErbB signaling pathway
ray04360  Axon guidance
ray04660  T cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107509617 (NCK2)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    107509617 (NCK2)
  09158 Development and regeneration
   04360 Axon guidance
    107509617 (NCK2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ray04990]
    107509617 (NCK2)
Domain-containing proteins not elsewhere classified [BR:ray04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   107509617 (NCK2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 SH3_10 hSH3 SH2_2
Other DBs
NCBI-GeneID: 107509617
NCBI-ProteinID: XP_015997760
LinkDB
Position
Unknown
AA seq 380 aa
MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKN
SLKKGSLVKNLKDTLGLGKTKRKTSARDASPTPSTDAEYPANGGGADRIYDLNIPAFVKF
AYVAEREDELSLVKGSRVTVMEKCSDGWWRGSYNGQIGWFPSNYVLEEVDEAAAESPSFL
SLRKGASLSNGQGARVLHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNA
RGQVGLVPKNYVVVLSDGPALPPSHAPQISYPGPAGSGRFAGREWYYGNVTRHQAECALN
ERGREGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFHTMDELVEHYK
KAPIFTSEHGEKLYLVRALQ
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgacagaagaagttattgttatagcaaagtgggactacactgcccaacaggaccaggag
cttgacatcaagaaaaatgagcgcctgtggctgctggatgactccaaaacgtggtggcgg
gtgaggaacgcggccaacaggacaggctacgtgccatccaactacgtggagaggaagaac
agcctgaagaagggctccctggtgaagaacctgaaggacacactcggcctcggcaagacc
aagaggaagacgagcgctcgggacgcatctccgacacccagcacagatgccgagtaccct
gcgaatgggggtggcgccgaccgcatctatgacctcaacatcccggccttcgtcaagttt
gcctacgtggcggagagggaggacgagctgtccctggtgaagggttcacgtgttaccgtc
atggagaagtgcagcgatggctggtggcgtggcagctacaacgggcagatcggctggttc
ccctccaactacgtcctggaggaggtggacgaggcggccgccgagtcccccagcttcctg
agcctgcggaagggcgcgtccctgagcaatggccagggcgcccgcgtcctgcacgtggtc
cagacgctgtaccccttcagctcggttaccgaggaggagctcaacttcgagaagggggag
accatggaggttatcgagaagccagagaacgaccccgagtggtggaaatgcaaaaacgcc
cgagggcaggtcggccttgtgcccaaaaactacgtagtggtcctcagtgacgggcccgcc
ctgcccccttcgcacgccccacagatcagctacccggggcctgccggcagtgggcgcttc
gcgggcagagagtggtactacgggaacgtgacgcgccaccaggctgagtgcgccctcaac
gagcggggccgcgagggtgacttcctcatcagggacagcgagtcctcgcccagtgacttc
tccgtgtctctcaaagcatcagggaagaacaaacatttcaaggtgcagcttgtggacaat
gtctactgcatcgggcagcggcggttccacaccatggacgagttggtggagcactacaaa
aaggcccccatcttcaccagcgagcacggggagaagctctacctcgtccgagcgcttcaa
tga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513946
Entry
107513946         CDS       T06036                                 

Gene name
NCK1
Definition
(RefSeq) cytoplasmic protein NCK1 isoform X1
  KO
K07365  NCK adaptor protein 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04012  ErbB signaling pathway
ray04360  Axon guidance
ray04660  T cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107513946 (NCK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    107513946 (NCK1)
  09158 Development and regeneration
   04360 Axon guidance
    107513946 (NCK1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ray04990]
    107513946 (NCK1)
Domain-containing proteins not elsewhere classified [BR:ray04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   107513946 (NCK1)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 SH3_10 hSH3 SH2_2
Other DBs
NCBI-GeneID: 107513946
NCBI-ProteinID: XP_016006642
LinkDB
Position
Unknown
AA seq 377 aa
MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKN
SARKASIVKNLKDTLGIGKVKRKPSVPDSASPADESFVDPGERLYDLNMPAFVKFNYMAE
REDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHMGSLSEKLA
AVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVG
LVPKNYVTIMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERG
HEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAP
IFTSEQGEKLYLIKHLS
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggcagaagaagtggtggtagtagccaaatttgattatgtggcccaacaagaacaagag
ctggacatcaagaagaatgagagattatggctcctggacgattctaaatcttggtggcga
gttcgaaattccatgaataaaacaggttttgtgccttctaactatgtggaaaggaaaaac
agtgctcgaaaagcttctattgtaaaaaatctaaaggatactttaggaattgggaaagtg
aaaagaaaacctagtgtgccagattctgcatctcctgctgatgaaagctttgttgatcca
ggggaacgtctctatgacctcaacatgcctgcatttgtgaaatttaactacatggcagag
agagaggatgaattatcattgataaaagggacgaaggtgatcgtcatggagaaatgcagt
gatgggtggtggcggggtagctacaatggacaagtcggatggttcccttcaaactatgta
actgaggaaggtgacagtcctttgggtgaccatatgggttctctgtcagagaaattagca
gcagtcgtcaataacctaaatactgggcaagtgttgcatgtggtacaggctctttaccca
ttcagctcgtccaatgatgaagaacttaattttgagaaaggagatgtaatggatgttatt
gaaaaacctgaaaatgaccccgaatggtggaaatgcaggaagatcaatggaatggttggt
ctggtgccaaaaaactatgttaccattatgcagaataatcccttaacctcaggtttggaa
ccatcacctccacagtgtgattacattaggccttcactcactggaaagtttgctggcaat
ccttggtattatgggaaagtcaccaggcatcaagcagaaatggcattaaatgaaagaggg
cacgaaggtgatttcctcattcgtgatagtgagtcttcgccaaatgatttctcagtatca
ctaaaagcacaagggaaaaacaagcattttaaagtccaactaaaagagactgtctactgc
attgggcagcgtaaattcagcaccatggaagaacttgtagaacattacaaaaaagcacca
atttttacaagtgaacaaggagaaaaattatatcttatcaagcatttatcatga

DBGET integrated database retrieval system