KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509818
Entry
107509818         CDS       T06036                                 

Gene name
ACVRL1
Definition
(RefSeq) serine/threonine-protein kinase receptor R3
  KO
K13594  activin receptor-like kinase 1 [EC:2.7.11.30]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107509818 (ACVRL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107509818 (ACVRL1)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     107509818 (ACVRL1)
Protein kinases [BR:ray01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   107509818 (ACVRL1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TGF_beta_GS APH DUF4381
Other DBs
NCBI-GeneID: 107509818
NCBI-ProteinID: XP_015998139
LinkDB
Position
Unknown
AA seq 503 aa
MTLDSRRKGLLMLLMALGLNQGGPVKPSRGPLVTCTCENPHCKGPTCQGAWCTVVLVREE
GRHPQEHRGCGNMHQELCRGRPTEFVNHYCCNSSLCNHNVSLVLKATPTPEQPQVDGQLP
LILGPVLALLALVALGTLGLWHVRRRQEKHRGLHSELGESSLILKASEQGDSMLGDLLDS
DCTTGSGSGLPFLVQRTVARQVALVECVGKGRYGEVWRGLWHGESVAVKIFSSRDEQSWF
RETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHYHEHGSLYDFLQRQTLEPQLAL
RLAVSAACGLAHLHVEIFGTQGKPAIAHRDLKSRNVLVKSNLQCCIADLGLAVMHSQGSD
YLDIGNNPRVGTKRYMAPEVLDEQIRTDCFESYKWTDIWAFGLVLWEIARRTIVNGIVED
YRPPFYDVVPNDPSFEDMKKVVCVDQQTPTIPNRLAADPVLSGLAQMMRECWYPNPSARL
TALRIKKTLQKLSNSLEKPKIIH
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgaccttggactctcgcaggaaaggccttctgatgctactaatggccttgggcttgaac
cagggtggccctgtgaagccctctcggggcccactggtgacctgtacgtgtgagaatcca
cactgcaaggggcctacctgccagggggcctggtgcaccgtagtgctggtgcgggaggag
ggcaggcaccctcaggaacataggggctgcgggaacatgcaccaggagctttgcaggggg
cgccccactgaattcgtcaaccactactgctgcaacagctccctctgcaaccacaatgtg
tccctggtgctgaaggccaccccaactccggagcagccgcaagtagatggccagctgcct
ctgatcctgggccctgtgttggccttgctggccctggtggccctgggtaccctgggcctg
tggcatgtccggcggaggcaggagaagcatcggggcctgcacagcgagttgggcgagtcc
agcctcatcctgaaggcatctgagcagggggacagcatgttgggggacctcctggacagt
gactgcaccacgggcagtggctcggggctccccttcctggtgcagaggacagtggcgcgg
caggttgccctggtggagtgtgtgggcaagggccgctatggtgaggtgtggcgaggccta
tggcatggcgagagtgtggctgtcaagatcttctcttcaagggatgaacagtcgtggttc
cgggagactgagatctacaatacagtgttgctcagacacgacaacatcctaggctttatc
gcctcggacatgacttcccgcaactcgagcacgcagctgtggctcatcacacactaccac
gagcatggctcgctctatgactttctgcagagacagacgctggagcctcagctggccctg
aggctagctgtgtccgcggcctgcggtctggcgcacttgcatgtggagatcttcggcacg
cagggcaaacccgccattgcccaccgtgacctcaagagtcgcaacgtgctggtcaagagc
aacctgcagtgttgcatcgcggacctgggcctggctgtgatgcactcccagggtagtgat
tacctggacattggcaacaatcctcgagtaggcaccaaacggtacatggccccagaggtg
ctggacgaacagatccgtaccgactgcttcgagtcctacaagtggactgacatctgggcc
tttggcctggtgctgtgggagatcgcccgccggaccattgtcaatggcatcgtggaagac
tacaggccacccttctatgatgtggtacccaatgatcccagctttgaggacatgaaaaag
gtggtgtgtgttgaccagcagacccccaccatccccaaccggctggctgcagacccggtc
ctctcaggcctggctcagatgatgcgggagtgctggtaccccaacccttctgcccgcctc
actgcactgcggatcaagaagacacttcagaaactcagcaacagtctggagaagcccaaa
ataattcactag

DBGET integrated database retrieval system