KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509821
Entry
107509821         CDS       T06036                                 

Gene name
ACVR1B
Definition
(RefSeq) activin receptor type-1B
  KO
K13567  activin receptor type-1B [EC:2.7.11.30]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04350  TGF-beta signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107509821 (ACVR1B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107509821 (ACVR1B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107509821 (ACVR1B)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     107509821 (ACVR1B)
Protein kinases [BR:ray01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   107509821 (ACVR1B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TGF_beta_GS APH Pkinase_fungal Activin_recp FTA2
Other DBs
NCBI-GeneID: 107509821
NCBI-ProteinID: XP_015998142
LinkDB
Position
Unknown
AA seq 453 aa
MVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDFCNKIDLRVPSGH
LKEPEHPSMWGPVELVGIIAGPVFLLFLIIIIVFLVINYHQRVYHNRQRLDMEDPSCEMC
LSKDKTLQDLVYDLSTSGSGSGLPLFVQRTVARTIVLQEIIGKGRFGEVWRGRWRGGDVA
VKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFD
YLNRYTVTIEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIA
DLGLAVRHDAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWE
IARRCNSGGVHEEYQLPYYDLVPSDPSIEEMRKVVCDQKLRPNIPNWWQSYEALRVMGKM
MRECWYANGAARLTALRIKKTLSQLSVQEDVKI
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggtttctattttcaacctggatgggatggagcaccatgtgcgcacctgcatccccaaa
gtggagctggtccccgctgggaagcccttttactgcctgagctctgaggatcttcgcaac
acccactgctgctacactgacttctgcaacaagattgacctgagggtgcccagtggtcac
ctcaaggagcctgagcatccttccatgtggggccctgtggagctggtcggcattattgcc
ggcccagtgttcctcctgtttctcatcatcatcattgttttccttgtcattaactatcat
cagcgtgtctatcacaaccgtcagaggctggacatggaggatccctcatgtgagatgtgt
ctttccaaagacaagacgctccaggatcttgtctacgatctctccacgtcggggtctggc
tcaggattaccccttttcgtccagcgcacagtggcccgaactatcgttttacaggagatt
attggcaagggccggtttggagaagtgtggcgtggccgctggagaggtggcgatgtggct
gtgaaaattttctcctcccgtgaagaacggtcttggttccgggaagcagagatataccag
acagtcatgctgcgtcatgaaaacattcttggatttatcgctgctgacaataaagataat
ggcacctggacccagctgtggcttgtctcggactatcatgagcatggctccctgtttgat
tatctcaaccggtacacagtgacgattgaggggatgattaagctggccttgtctgccgcc
agcgggcttgcacacctgcacatggagatcgtgggcacccaagggaagcctggaattgct
catcgagacttaaagtcaaagaatatcctggtgaagaaaaacggcatgtgcgccatcgca
gacctgggtctggctgtccgtcacgatgcggtcactgataccattgacattgctccaaat
cagagggtgggaaccaaacgatacatggcccctgaagtacttgatgaaaccattaacatg
aagcactttgactcttttaaatgtgctgatatctatgcccttggacttgtatattgggag
attgcccgaagatgcaattctggaggagtccatgaagaatatcagctgccatattatgac
ttagtgccctctgacccttctattgaagaaatgcgaaaggtcgtttgtgaccagaagcta
cgtcccaacatccccaactggtggcagagttatgaggcattacgagtgatggggaagatg
atgcgggagtgttggtatgccaacggcgcggcccgcctgactgctctgcgcattaagaag
accctttcccagctcagcgtgcaggaagatgtgaagatttaa

DBGET integrated database retrieval system