KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509850
Entry
107509850         CDS       T06036                                 

Gene name
ESPL1
Definition
(RefSeq) separin isoform X1
  KO
K02365  separase [EC:3.4.22.49]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107509850 (ESPL1)
   04114 Oocyte meiosis
    107509850 (ESPL1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107509850 (ESPL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ray01002]
    107509850 (ESPL1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107509850 (ESPL1)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     107509850 (ESPL1)
Peptidases and inhibitors [BR:ray01002]
 Cysteine peptidases
  Family C50: separase family
   107509850 (ESPL1)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Separase
    107509850 (ESPL1)
SSDB
Motif
Pfam: Peptidase_C50 CHAT
Other DBs
NCBI-GeneID: 107509850
NCBI-ProteinID: XP_015998205
LinkDB
Position
Unknown
AA seq 2115 aa
MRSFKGVNFGTLLSNPKEAEELLPDLKEFLSKLPAGSSSCRFDAERRQTCDTILRACNQQ
LTAKLACHRHLGSLLELAELACNGYLASNPQCPPLYLERILFIFLRNVAAQGIPEATLRL
AQPLHACLVQCSPQAAPQDYEAVARGSFSLLWKGAEALVEQRAAYSARLKALSFLVLLED
ESTPCEVPHFASPTACRVVAAHQLFDASGHGLNEADADFLDDQLSRHVIRALVSEGGDSP
GLSPQKALCLLELTVEHCRRLCWSRLYTKATKAVEKAQDYLRKTSLAPSLQLCQLGIKLL
QVQEGGPHTVAKLLIKASALLNSSMEAPSPPLRALYDSCQFFFSGLERRTKRRYGPDAIR
GLFAFLSGYYSLIQQLQDDVCGDSSKQHQSLVQMHFQGLHLYTVVVYDFAQGCQVADLAD
LAQLVESCKSTVVWMLEALQGLSGRELTDYLGMTASYTSNLTYSFYSHKLYAEACAISEP
FCQHLGLVKPGTHPAVPPEKLHRCFRLHVESLKKLGKQAQGCKMVALWLAALQPCDPKYM
AEPVTFWVRVKMDAARAGDKELQLRTLRDNLNSWDPETLALLLREELQAYKAVRADTGQE
RFNIICDLLELTPEETPAGAWARATHLVELAQVLCYHDFAQQTNCSALDAIREALQLLEC
VKPETQAEDQLLDDKAQALLWLYICTLETKMREGIEQDRKAQAPSNLEEFEVNDLNYEDK
LQEDRFLYSNIAFNLAADAAQSKCLDQALALWKEVLTKEEAPALRCLQQTAASLQILAAL
YQLVAKPLQALDVLLLVRIVSQRLEDHAKAAGSSCHVTQLLLTLGCPSYAQLHLEEAESS
LKFLDRTTDTYLLLSLTCDLLRSQLCYAYRKVTEGASLLLSVLQDPALQRSSKAWYLLRV
QALQLVAVYLSLSSDSLSASLWEQLCAQGWQTPEIALIDSHKLLRSIILLLMGSDVLSIQ
KVAVETPFLDYGENLMQKWQVLAEVLSCSEKLVSRLGCLGSVSEAKAFCLEALKLTTKLQ
IPRQCALFLVLKGELELARNDIDLCQSDLRQVLFLLESCTEFCGLAQHPDSVKKVRLQKG
QQQAQIPCPPELPEEEVFLRGPVLELVATVAKEPGPITPSTNSSPILKTKPQPSPGFLTH
SPTCDCSLCASPVLSAVCLRWVLVTAGVRLAMGHQAQSLDLLQVVLKGCPAATERLTQAL
QASLNHKAPPSPIPSLFDEILAQAYTQLAQEVLNGPSNKNLEKVLESGLKFVAARIPYLE
PWRANLLLIQALAKLAGLSCCTTQLFASSWGWQQPSIKTPPGSEPSKLRSQKHSGRGRQQ
VVSATLPLHNTSRKGLKGLEGGGPPCTPKPPGRLRLASPRVPFTVFEDGSPTQSKPEILK
APRVQQRVQTRLKVNFSDDSDLEDPVETRLLEGPKRRGVASRGRGRGQTRKGSSLKTDTV
AAPGSAPGHSGLSGRSRRAKKVASRHCEELGPEIMRTIPEELLTDNQMEMSFEILRGSDG
KDSASGGKTSAPGPDTAIGECEVLRRDSSKLELPLLCPDKERDKDLGPQLRCPSASVAIG
ISTLDSIRDSLSVAFRGIRHCPPSGLYTHLCRLLALCLGHQDPYATACLVTESVSITCRH
QLLTHLHRQLSKAQKHRGSLEIAEQLQDLSLQEKPGDVPLAHIQSLFSFRTSGSGHFPQP
EKESFQEHLALIPSGVTVCVLALATLQPRTVGNTLLLTRLEKDNPPVTVQIPTAQNKFPL
SSALKEFDAIQKEQKENSSCTDKREWWTGRLELDHRMEVLITSLEKHVLGCWRGLLLPSS
EDPGPAQEASHLQELLQECGWKYPDSTLLKVMLSGANTLTPQDIQTLAYGLCPAWPERAQ
ELLSEAIGRLQGQTVLSNRHLVLVLDKDLQKLPWESMPSLRALPVTRLPSFRFLLSYTSI
KESGASSVLSQGVDPRSTFYVLNPHNNLSSTEEQFRANFSRSGEYDEAGWKGVIGEVPSP
EQVQAALTEHDLYIYAGHGAGARFLDGQAVLRLSCRPVALLFGCSSAALAVHGNLEGAGI
VLKYIMAGCPLFLGNLWDVTDRDIDRYTEALLQGWLGAGPGAPLLYYVNQARQAPRLKYL
IGAAPVAYGLPVSLR
NT seq 6348 nt   +upstreamnt  +downstreamnt
atgaggagcttcaaaggagtcaactttgggactctgctaagcaacccgaaggaggctgaa
gagttgttgcctgacttgaaggagttcttgtccaaacttccagctggttcttccagttgc
cgatttgatgccgaaaggagacaaacttgtgataccatcctgagggcttgcaaccagcag
ctgactgctaagctagcttgccataggcacctagggagcctgctggagctggcagaactg
gcttgcaatggctacttggcgtccaacccccagtgcccacccctctacctggaacgaatt
ctcttcatctttctgcggaatgttgctgcacagggaatcccagaggccacactccgactt
gctcagccccttcatgcctgcttggtgcagtgttctccccaagctgctccccaggattat
gaggctgtggctcggggcagtttttctctgctttggaagggggcagaagccctggtggag
cagcgagctgcatactcagctcgactgaaggccttgagctttctagtactcttggaggat
gaaagtaccccttgtgaggttccccactttgcttctccaacagcttgtcgagtggtagct
gctcatcagctctttgatgccagtgggcatggtctgaatgaagcagatgctgatttccta
gatgaccaactctccaggcatgtaatcagagccttggtgagtgagggaggggactctcct
ggtctctctccccagaaggccctctgtctcttggaactcaccgtggaacactgccgtcgc
ctctgctggagccgcctctacaccaaggccaccaaggcagtagagaaagcccaggattac
ctaaggaaaaccagtcttgcccccagcctccagctgtgccagctggggattaaactgctg
caggtccaggagggaggaccccacacagtggccaagcttctgatcaaggcatcagctctc
ctgaacagcagtatggaggcaccgtcacccccactgcgggcattgtatgacagttgccag
ttcttcttctcaggcctggagcggcgcaccaagaggcgctatggacctgatgctattcgg
ggcctctttgcttttcttagcggttactactccctcattcagcagctgcaggatgatgtc
tgtggggactcctccaagcagcaccagtctttggttcagatgcattttcagggacttcat
ctctacactgtggtggtttatgactttgcccaaggctgtcaggtagctgatttggctgac
ttagcccagctagtggaaagttgcaaatctactgttgtctggatgctggaggccttacag
ggcctgtcaggccgagagctgactgactacctggggatgactgcctcttacaccagtaac
ttgacctacagtttctatagtcacaagctctatgccgaggcctgtgccatctctgagcct
ttctgtcagcatctgggcttggtgaagccaggcacccatcctgcagtgcctcctgagaag
ttacacaggtgcttccggctacatgtagagagtttaaagaaactgggtaaacaggcccaa
ggctgcaagatggtggctttgtggctggcagccttgcagccttgtgaccccaaatacatg
gccgagccagtcaccttttgggtccgggtcaagatggatgctgccagagctggagacaag
gaactacagctgaggactctgcgagacaatctaaacagctgggacccagaaaccctggcc
ctcctgcttagggaagagctgcaggcctacaaggcagtgcgggccgatacaggacaggaa
cggttcaacatcatctgtgacctgctggagctgacccctgaggagacaccagctggggcc
tgggctcgagccacccacctggtggaattggctcaggtgctctgctaccatgactttgcc
cagcagactaactgctctgccctggatgctatccgggaagctttacagcttctggagtgt
gtgaagcctgagactcaggccgaggatcagctcctggatgataaagcacaagccctgctg
tggctttacatctgtaccctggagaccaaaatgcgggagggtatcgagcaggatcggaaa
gcccaggcccctagtaacctggaggaatttgaagtcaatgacctgaactatgaagataaa
ctccaggaagatcgttttctatacagtaacattgccttcaacctggctgcagatgctgct
cagtccaaatgcctggaccaagccctggccctgtggaaggaggtgcttacaaaggaggag
gctcccgctttgcggtgtctccagcagacagcagcctcactgcagatcctagcggccctc
tatcagctggtggcaaagcccctgcaggctctggatgtcctactgcttgtacggattgtc
tcccagagactggaggaccacgcaaaggcagctggctcctcctgccacgtcacccagctc
ctcctgacactcggctgtcccagctatgcccagttacacctggaagaggcagaatcaagt
ctgaagtttctggatcgtaccactgacacatacctgctcctttccttgacctgtgaccta
ctgagaagtcaactctgctatgcttaccgcaaggtgacggagggtgcctctctgttgctg
tctgtgcttcaggaccctgcccttcagaggtcatccaaggcctggtacttgctgcgtgtc
caggctctgcagctggtggcagtctaccttagcctctcatcagacagcctatcagcttcc
ctgtgggagcagctctgtgctcaaggctggcagacacctgaaatagcactcattgactcc
cataagctcctccgaagcatcattctcctgctcatgggcagcgatgtgctctcaattcaa
aaagtagctgtggagacaccttttctggactatggtgaaaatctgatgcaaaaatggcag
gtgcttgcagaggtgctgagctgctcagagaagctggtctcccgtctgggctgcctaggt
agtgtgagcgaagccaaggccttttgcttggaggccctgaaacttacaacaaagctacag
ataccacgccagtgcgccctgttcctggtgctgaagggggagctggagttggcacgcaat
gatatcgacctctgtcagtcagacctacgacaggttctcttcttgcttgagtcttgcaca
gagttttgtggactagcccagcacccggactctgtgaagaaggtccgcttgcagaagggg
cagcagcaagcccagatcccctgtcctccagagctcccagaagaggaagtcttcctaaga
ggccctgttctggagctggtggccacagtggccaaggagcctggccccataacaccttct
actaactcctccccaatcctgaaaacaaagcctcagcctagccctggcttcctgacccat
tcgcccacctgtgactgctcgctctgtgccagccctgtcctctcagcggtctgtctacga
tgggtgttggtcacagcaggggtgagactggccatgggccatcaggcccagagtctggat
cttttgcaagtcgtgctaaagggttgccctgcagccactgagcgcctcactcaagctcta
caggcttccctgaatcacaaagcacccccctccccgatcccgagcctctttgatgagatc
ttggctcaggcatacacacaattggcacaggaggtgctgaatgggccatcaaacaagaac
ctggagaaggtcctggagtcagggctgaagtttgtagcagcgcggataccctacctggag
ccctggcgagccaacctgctcttgattcaggcccttgcaaagctggctggactcagctgc
tgcactacccaactttttgcaagctcctggggctggcagcagccatcaataaagacccca
ccaggctcagagccctctaagcttcggagccaaaaacattctggacgagggcgccagcag
gtggtctctgctacccttcccctccataatacctctcggaaaggtctgaaaggtctggaa
ggtggaggaccaccctgtacacctaagcccccaggcaggcttaggctagccagccctcgt
gtccctttcactgtgtttgaggatggctctcctacacagagcaagcctgaaattctcaag
gcccccagggtacaacagagggtccagacccgcctgaaggtgaacttcagtgatgacagt
gacttggaagacccagttgagacacggcttttagaggggcccaagagacggggcgttgct
tcccggggcagaggccggggccagactaggaagggctcgagcttgaagactgatacagtg
gctgccccaggtagtgcccctgggcactctggcctcagtggcaggagccggagggccaag
aaggttgcgtcaagacattgtgaggagctgggtcctgagattatgaggaccatccctgag
gagttgctgactgacaaccagatggaaatgagctttgagatcctcaggggctctgatggg
aaagactcggcctcaggtggaaagacatcagctccagggcctgacacagccataggagaa
tgtgaggtgttgagacgggattccagcaaattggagctgcccctcctgtgcccagataag
gagagagacaaggatcttggtcctcagctccgatgcccttcggcctctgtagccattggt
atctctaccctggattccatccgtgactcactgagtgttgctttccgtgggatccgtcac
tgccctcctagtgggctctacactcacctctgccgcctcctggccttgtgcctgggccac
caggatccctatgccactgcctgcctcgtcactgagtctgtctccatcacctgtcgccac
cagctgctcacccaccttcacaggcagctcagcaaggctcagaagcaccgaggatcactt
gaaatagcagaacagttgcaagacctgagtctccaggagaagcctggagatgtcccccta
gcccacatccagagcctcttttccttcaggacttcaggatctggccatttcccccagcct
gagaaggagagtttccaggagcacctggctctgatccccagtggggtgactgtgtgtgtg
ttggccctggccaccctccagcctcgaacagtgggcaacaccctcctgctgacccggctg
gaaaaagacaatcccccggtcactgtgcagatacccactgcccagaacaagtttcctctg
agttcagccctgaaagagtttgatgccatccagaaagaacagaaagagaacagcagctgt
actgacaaacgagaatggtggacagggcggctagaactggaccataggatggaggttctc
atcacttccctagagaagcatgtgttgggctgctggagggggctgttgctgccatccagt
gaagaccctggccctgctcaggaggcctcccacctacaagagttgctgcaggaatgtggc
tggaaatatcctgactccactctgctgaaagtcatgctcagtggtgccaataccctcacc
cctcaggacattcagactctggcctatgggctgtgcccagcctggccagagcgagcccaa
gaactcctgagtgaggccataggacgtctacaggggcagacagtactaagcaataggcac
cttgtcttagtgctggacaaggacctgcaaaagctgccatgggagagcatgcccagcctc
agggcactgcctgtcactcgactgccctcctttcgctttctactcagctacaccagcatc
aaagagtctggggcctcgtcagtgctgagccaaggggtggatccgcgcagtaccttctat
gttctgaaccctcacaataacctgtcaagcacagaggagcaatttcgagccaattttagc
aggtcaggagaatacgatgaagctggctggaaaggagtgattggggaggtgccgagccca
gaacaggtgcaggcagccctgacggagcatgacttatacatctatgcagggcatggggcc
ggtgcccgcttcctggatgggcaggctgtcctgcggctgagctgccggccagtggccctg
ctgtttggctgcagcagtgcagccctggctgtgcatggaaacctggagggggctggcatc
gtgctcaagtatatcatggctggctgtcccctgtttctgggtaacctctgggatgtgact
gaccgtgacatcgaccgctacacagaggcgctgctgcagggctggcttggagcaggccca
ggagcccctcttctctactatgtcaaccaggcccgccaggctcctcgactcaagtatctt
attggggcagcacctgtagcctacggcttgcctgtctccctgcggtga

DBGET integrated database retrieval system