KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509855
Entry
107509855         CDS       T06036                                 

Gene name
SP1
Definition
(RefSeq) transcription factor Sp1
  KO
K04684  transcription factor Sp1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04137  Mitophagy - animal
ray04350  TGF-beta signaling pathway
ray04915  Estrogen signaling pathway
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04934  Cushing syndrome
ray05016  Huntington disease
ray05017  Spinocerebellar ataxia
ray05163  Human cytomegalovirus infection
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05224  Breast cancer
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107509855 (SP1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107509855 (SP1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107509855 (SP1)
   04928 Parathyroid hormone synthesis, secretion and action
    107509855 (SP1)
   04927 Cortisol synthesis and secretion
    107509855 (SP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107509855 (SP1)
   05202 Transcriptional misregulation in cancer
    107509855 (SP1)
   05231 Choline metabolism in cancer
    107509855 (SP1)
  09162 Cancer: specific types
   05224 Breast cancer
    107509855 (SP1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    107509855 (SP1)
   05017 Spinocerebellar ataxia
    107509855 (SP1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107509855 (SP1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107509855 (SP1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107509855 (SP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107509855 (SP1)
   03029 Mitochondrial biogenesis [BR:ray03029]
    107509855 (SP1)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    107509855 (SP1)
Mitochondrial biogenesis [BR:ray03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    107509855 (SP1)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_8 zf-C2H2_6
Other DBs
NCBI-GeneID: 107509855
NCBI-ProteinID: XP_015998213
LinkDB
Position
Unknown
AA seq 790 aa
MSDQDHSMDEMTAVVKIEKGVGGSNGGNGNGSGAFSQARSSSTGSSSSSGGGGGGGGQES
QPSPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGA
TPTSKEQSGSSTNGSNGSEPSKNRTVSGGQYVVAATSNLQNQQVLTGLPGVMPNIQYQVI
PQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAV
PLQGLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESSS
QPVTSGTAISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTTSGSAGTNSQGQT
PQRVSGLQGSDALNMQQNQTSGGSLQASQQKEGEQNQQSQQQQILIQPQLVQGGQTLQAL
QAAPLSGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQ
NPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLS
ALGASGIQVHQLPSLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDPQPQA
GRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHIPGCGKVYGKTSHLRAHLRWHTGERP
FICTWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGP
GVALSVGTLPLDSGAGSEGSGATTSSALIATNMVAMEAICPEGIARLANSGINVMQVADL
QSINISGNGF
NT seq 2373 nt   +upstreamnt  +downstreamnt
atgagcgaccaagatcactccatggatgaaatgacagccgtggtgaagattgaaaaaggt
gttggtggcagtaatgggggcaatggtaatggtagtggtgccttttcccaggctcgaagc
agcagcacgggcagcagcagcagcagtggaggaggaggaggaggaggaggacaggaatcc
cagccatcccctttggctctgctggcagcaacttgcagcagaattgaatcacctaatgaa
aacagcaacaactcccagggcccaagccagtcagggggcacaggtgagcttgaccttaca
gccacacaactctcacagggtgccaatggctggcagatcatctcttcctcctctggggct
acccctacctcaaaggaacagagtggcagcagtaccaatggcagcaatggcagtgagcct
tccaagaatcgcacagtctctggtgggcagtacgttgtggctgccacttccaacttacag
aaccagcaagttctgacaggactgcctggagtgatgcctaatattcagtatcaagtaatc
ccacagttccagactgttgatgggcaacagctgcagtttgctgccactggggcccaagtg
cagcaggatggttctggtcaaatacagatcataccaggtgcaaaccagcagatcatcaca
aatcgtggaagtggaggcaacatcattgctgctatgccaaatctactccagcaagctgtc
cccctccaaggcctggctaataatgtactctcaggacagactcagtatgtgaccaatgta
ccagtggccctgaatgggaatatcaccttgctacccgtcaacagcgtttctgcagctacc
ttgactcctagctctcaggcagtcacgatcagcagctctgggtcccaggagagcagctca
cagcctgtcacctcagggactgccatcagttctgccagtttggtatcatcacaagccagt
tccagctcctttttcaccaatgccaatagctattcaacaactactaccaccagcaatatg
ggaattatgaactttaccaccaccagcggatcagcagggaccaactctcaaggccagaca
ccccagagggtcagtgggctacaggggtctgatgctctgaacatgcagcagaaccagaca
tctggaggctcactgcaagcaagtcagcaaaaagagggagagcaaaaccagcagtcacag
caacaacaaattcttatccagcctcagctagttcaagggggacagaccctccaggccctt
caggcagcaccattgtcagggcagaccttcacaactcaagctatctcccaggaaaccctc
cagaatctccagcttcaggctgttccaaactctggtcccatcatcatccggacaccaaca
gtggggcccaatggacaggtcagttggcagactcttcagctgcaaaacctccaagttcag
aacccacaggcccagacaatcaccttggccccaatgcagggtgtttccctggggcagacc
agcagcagtaataccacccttacacccattgcctcagctgcctctatccctgccggcaca
gtcactgtgaatgctgctcaactctcctccatgcctggcctccagaccataaacctcagt
gcattgggtgcttcaggaatccaggtgcaccagcttccaagcctgccgttagctatagca
aatgccccaggtgatcacggagctcagcttggcctccatggagctggtggtgatggaata
catgatgacacagcagggggagaggaaggagagaacagcccagatccccaaccccaggca
ggtcggaggacccggcgggaagcatgcacctgcccctactgtaaagacagtgaaggaagg
ggctcaggggatcctggcaaaaagaaacagcatatttgccacattccaggctgtggcaaa
gtatatggcaagacctcacacctacgggcacacttgcgctggcatacaggcgagagacca
tttatatgtacctggtcatactgtgggaaacgcttcacacgttcggatgagctacagagg
cacaaacgcacacacacaggtgaaaagaaatttgcctgtcctgagtgtcccaagcgcttc
atgaggagtgaccacctgtcaaagcatatcaagacccaccagaataagaagggaggccca
ggtgtagccctgagtgtgggcactttgcccctggacagtggggcaggttcagaaggcagt
ggcgctaccacttcttcggcccttattgctaccaatatggtagctatggaggccatctgt
ccagagggtattgcccgtcttgccaacagtggcatcaacgttatgcaggtggcagatctg
cagtccattaatatcagtggcaatggcttctga

DBGET integrated database retrieval system