KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509856
Entry
107509856         CDS       T06036                                 

Gene name
AMHR2
Definition
(RefSeq) LOW QUALITY PROTEIN: anti-Muellerian hormone type-2 receptor
  KO
K04672  anti-mullerian hormone receptor type-2 [EC:2.7.11.30]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107509856 (AMHR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107509856 (AMHR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107509856 (AMHR2)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     107509856 (AMHR2)
Protein kinases [BR:ray01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   107509856 (AMHR2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Activin_recp Sensor Pkinase_fungal APH Trypan_PARP
Other DBs
NCBI-GeneID: 107509856
NCBI-ProteinID: XP_015998214
LinkDB
Position
Unknown
AA seq 652 aa
MRLVLHSSLSLPAFPHTHPLPRSSRLPHRDWEEGGGRSWGLRDQKPHDALYLRKALGRGS
CAGSCFPPPVAASFKMILGTLGLWALLPAAVQAPPSRRTCVFFEAPGVRGSTQTLGQLLD
AGPGPPRAIRCLYSRCCFGIWNLTQDLAQVEMQGCRDSDEPGCESPHCDPSPRAQPSPGS
TLFTCSCGTDFCNANYSHLPPLGSPGTPGSQSPLATPGESIWMALVLLGLFLLLLLLGSI
ILALLQRKVCRVQGVPEPEPEPEPEPDSGRDWSVELPQLPDLCFSQVIREGSHAVVWAGQ
LQGELVAIKAFPMRAAAQFRAERALYELPGLRHDHIVRFITASRGGPGPLPCGPLLVLEL
HPKGSLCHYLTQYTSDWGSSLRMALSLAQGLAFLHEERWQDGQYKPGIAHRDLSSQNVLI
REDGSCAIGDLGLALVLPGLTQAPTWAPTQPRGPAAIMEAGTQRYMAPELLDKTLDLQNW
GMALRRADVYSLALLLWEILSRCQDLQPDSRPPPFQLAYEAELGSTPTTCELWTLAVEER
RRPYIPPTWHCFATDPAGLRELLEDCWDADPEARLTAECVQQRLATLAHPQESHSFPEGY
SHSCPPLCPEDCLSTPPHTILPCRPQLRICHFSVQQSPCSRNSQPAGTISHV
NT seq 1959 nt   +upstreamnt  +downstreamnt
atgagattggttctccactcctccctctctctccctgcttttccccatacccatcctctc
ccccgcagcagccgtctcccccacagagactgggaagagggaggggggcggagttgggga
ctgagggatcagaagccccacgatgccctgtatctgaggaaagctctgggcaggggcagc
tgtgctggctcatgcttccctcctcctgttgctgcttccttcaaaatgatcctgggtact
ctggggctttgggcactgcttcctgcagctgtgcaagcacccccaagcaggcggacctgt
gtgttctttgaggcccctggagtgcgtgggagcacacaaacactggggcagctgctagat
gcaggaccagggccccccagggctattcgctgcctctacagccgctgctgctttgggatc
tggaacctgacccaagatctggcacaggtggagatgcaaggatgccgagacagcgatgag
ccaggctgtgagtcgccccactgtgacccgagccccagagcccagcccagccctggctcc
actctcttcacctgttcctgtggcactgacttctgcaatgctaattacagccatctgcct
cctctgggcagcccggggactcctggctcccagagtcccctggccaccccaggcgagtct
atttggatggcgctggtgctactggggctgttcctcctcctcctgctgctgggcagcatc
atcttggccctgctacagcgaaaggtctgcagagtgcaaggtgtgccagagccagaacca
gagccagagccagagccagactcaggcagggactggagtgtggagctgcctcagctgcct
gacctgtgcttctcccaggtaatacgggaaggaagtcatgcagttgtgtgggctgggcag
ctgcaaggcgagctggtagccatcaaggccttccccatgagggcggcggcccagttccga
gctgagagagcattgtatgagctgccaggcctacggcatgaccacattgtccgctttatc
acggccagcagggggggccctggccccctgccctgtgggcccctgctggtgttggagctg
caccccaagggctccctgtgtcactacttgacccagtacaccagtgactggggaagttcc
ctgaggatggcactctctctggcacagggcctggcatttctccatgaggagcgctggcag
gatggccagtacaaaccaggtattgcccaccgagatctgagcagccagaatgtgctcatt
cgggaggatgggtcatgtgctattggagacctgggcctcgctttggtgctccctggcctc
actcaggctcccacctgggcccctactcaaccccgaggcccagctgccatcatggaggct
ggtacccagaggtacatggcaccagagctcttggacaagaccctggacctacagaactgg
ggtatggccctccggcgagctgatgtttattctctggctctgctcctatgggagatcctg
agccgctgccaagatttgcaacctgacagcaggccaccaccctttcaattggcctatgag
gcagaactgggcagcacccccaccacctgtgaactttggaccttggcagtagaagagaga
aggcgcccctacatcccacccacctggcactgctttgccacggaccctgctggcctgaga
gaactcctagaggactgttgggatgcagacccagaagcacggctgacagctgagtgtgta
cagcagcgcctggctaccctggcccatcctcaagagtcccactccttcccagagggttat
tcacatagctgcccacctctctgcccagaagactgtctctcaactcctccccataccatt
ctcccttgtaggcctcagctgagaatctgccacttcagtgttcagcaaagcccttgttcc
aggaattctcaacctgctggtaccatttctcatgtgtaa

DBGET integrated database retrieval system