KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509897
Entry
107509897         CDS       T06036                                 

Gene name
BMPR1A
Definition
(RefSeq) bone morphogenetic protein receptor type-1A
  KO
K04673  bone morphogenetic protein receptor type-1A [EC:2.7.11.30]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04350  TGF-beta signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107509897 (BMPR1A)
   04390 Hippo signaling pathway
    107509897 (BMPR1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107509897 (BMPR1A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107509897 (BMPR1A)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107509897 (BMPR1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107509897 (BMPR1A)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ray04090]
    107509897 (BMPR1A)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     107509897 (BMPR1A)
Protein kinases [BR:ray01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   107509897 (BMPR1A)
CD molecules [BR:ray04090]
 Proteins
  107509897 (BMPR1A)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TGF_beta_GS Activin_recp Pkinase_fungal FTA2
Other DBs
NCBI-GeneID: 107509897
NCBI-ProteinID: XP_015998282
LinkDB
Position
Unknown
AA seq 532 aa
MTQLYIYIQLLGAYLFIISHVQGQNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLK
CYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRR
TIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRWLVVLISMAICIIAMIIFSSCFCYKHYC
KSISSRSRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQV
GKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTG
SWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAH
RDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKN
HFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLR
PIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgactcagctatatatttatatccaattattgggagcctatctgttcatcatttctcat
gttcaagggcagaatctagacagcatgctccatggtactgggatgaaatcagactcagac
cagaaaaagtcagaaaatggagtaaccttagcaccagaggataccttaccttttttaaag
tgctattgctcaggtcactgcccagatgatgctattaataacacatgcataactaatggg
cattgctttgccatcatagaagaagatgaccagggagaaacaacattagcttcagggtgt
atgaaatatgaaggatcagattttcagtgtaaggattcaccaaaagcccagctacgccgg
acaatagaatgctgtcggaccaatttatgtaaccagtatttacagccaacactgccccct
gttgttataggtccatttttcgatggtagcattcgatggctggttgtgctcatttcaatg
gctatctgcataattgctatgatcatcttctccagctgcttttgttacaaacattattgt
aagagcatctcaagcagaagtcgttataatcgagatttggaacaggatgaagcatttatt
ccagttggagaatcattaaaagacctcattgaccagtcacaaagttctggtagtggatct
ggactacctttattggttcagcgaactattgccaaacagattcagatggttcggcaagtt
ggtaaaggccgatacggagaagtgtggatgggtaaatggcgtggtgaaaaagtagcagtc
aaagtgttttttaccactgaagaagctagctggtttcgagaaacagaaatctatcaaact
gtgctaatgcgccatgaaaatatacttggttttatagcagcagacattaaaggtacaggt
tcctggactcagctctatttgattactgactaccatgaaaatggatctctctatgatttc
ctgaaatgtgctacattagacaccagagctctcctcaagttggcttattcagctgcttgt
ggtctgtgccatctccacacagaaatttatggcacccaaggaaagcctgcaattgctcac
cgagacctaaagagcaaaaacattctcatcaagaaaaatggaagttgttgtattgctgac
ttgggccttgctgttaaattcaacagtgatacaaatgaagtcgatgtacccttgaatacc
agggtgggtaccaaacgctacatggctccagaagtgctagatgaaagcctgaataaaaac
catttccagccctacataatggcagacatctatagctttggcctaataatttgggaaatg
gctcgtcgttgtatcacaggagggatagtagaagagtaccagttgccatattacaacatg
gtacccagtgatccatcatatgaagacatgcgtgaggttgtgtgtgtcaaacgtttgcgg
ccaattgtgtctaatcgatggaacagtgatgaatgtctacgagcagttttgaagctaatg
tcagaatgctgggcccacaatccagcttctagacttacggctctgagaatcaagaagaca
cttgctaagatggttgaatcccaagatgtaaagatttga

DBGET integrated database retrieval system