KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509910
Entry
107509910         CDS       T06036                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04024  cAMP signaling pathway
ray04068  FoxO signaling pathway
ray04071  Sphingolipid signaling pathway
ray04137  Mitophagy - animal
ray04140  Autophagy - animal
ray04141  Protein processing in endoplasmic reticulum
ray04210  Apoptosis
ray04215  Apoptosis - multiple species
ray04217  Necroptosis
ray04310  Wnt signaling pathway
ray04380  Osteoclast differentiation
ray04510  Focal adhesion
ray04530  Tight junction
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04657  IL-17 signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04660  T cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04668  TNF signaling pathway
ray04722  Neurotrophin signaling pathway
ray04723  Retrograde endocannabinoid signaling
ray04728  Dopaminergic synapse
ray04750  Inflammatory mediator regulation of TRP channels
ray04910  Insulin signaling pathway
ray04912  GnRH signaling pathway
ray04914  Progesterone-mediated oocyte maturation
ray04917  Prolactin signaling pathway
ray04920  Adipocytokine signaling pathway
ray04926  Relaxin signaling pathway
ray04930  Type II diabetes mellitus
ray04931  Insulin resistance
ray04932  Non-alcoholic fatty liver disease
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04935  Growth hormone synthesis, secretion and action
ray05010  Alzheimer disease
ray05012  Parkinson disease
ray05016  Huntington disease
ray05017  Spinocerebellar ataxia
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
ray05133  Pertussis
ray05135  Yersinia infection
ray05142  Chagas disease
ray05145  Toxoplasmosis
ray05152  Tuberculosis
ray05161  Hepatitis B
ray05162  Measles
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05210  Colorectal cancer
ray05212  Pancreatic cancer
ray05231  Choline metabolism in cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107509910 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107509910 (MAPK8)
   04012 ErbB signaling pathway
    107509910 (MAPK8)
   04014 Ras signaling pathway
    107509910 (MAPK8)
   04310 Wnt signaling pathway
    107509910 (MAPK8)
   04668 TNF signaling pathway
    107509910 (MAPK8)
   04068 FoxO signaling pathway
    107509910 (MAPK8)
   04071 Sphingolipid signaling pathway
    107509910 (MAPK8)
   04024 cAMP signaling pathway
    107509910 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107509910 (MAPK8)
   04137 Mitophagy - animal
    107509910 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    107509910 (MAPK8)
   04215 Apoptosis - multiple species
    107509910 (MAPK8)
   04217 Necroptosis
    107509910 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107509910 (MAPK8)
   04530 Tight junction
    107509910 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107509910 (MAPK8)
   04621 NOD-like receptor signaling pathway
    107509910 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    107509910 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    107509910 (MAPK8)
   04660 T cell receptor signaling pathway
    107509910 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    107509910 (MAPK8)
   04659 Th17 cell differentiation
    107509910 (MAPK8)
   04657 IL-17 signaling pathway
    107509910 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    107509910 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107509910 (MAPK8)
   04920 Adipocytokine signaling pathway
    107509910 (MAPK8)
   04912 GnRH signaling pathway
    107509910 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    107509910 (MAPK8)
   04917 Prolactin signaling pathway
    107509910 (MAPK8)
   04926 Relaxin signaling pathway
    107509910 (MAPK8)
   04935 Growth hormone synthesis, secretion and action
    107509910 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    107509910 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    107509910 (MAPK8)
   04722 Neurotrophin signaling pathway
    107509910 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107509910 (MAPK8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107509910 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107509910 (MAPK8)
   05231 Choline metabolism in cancer
    107509910 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107509910 (MAPK8)
   05212 Pancreatic cancer
    107509910 (MAPK8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107509910 (MAPK8)
   05012 Parkinson disease
    107509910 (MAPK8)
   05016 Huntington disease
    107509910 (MAPK8)
   05017 Spinocerebellar ataxia
    107509910 (MAPK8)
   05020 Prion disease
    107509910 (MAPK8)
   05022 Pathways of neurodegeneration - multiple diseases
    107509910 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107509910 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107509910 (MAPK8)
   04932 Non-alcoholic fatty liver disease
    107509910 (MAPK8)
   04931 Insulin resistance
    107509910 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107509910 (MAPK8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107509910 (MAPK8)
   05135 Yersinia infection
    107509910 (MAPK8)
   05133 Pertussis
    107509910 (MAPK8)
   05152 Tuberculosis
    107509910 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107509910 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    107509910 (MAPK8)
   05161 Hepatitis B
    107509910 (MAPK8)
   05171 Coronavirus disease - COVID-19
    107509910 (MAPK8)
   05162 Measles
    107509910 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107509910 (MAPK8)
   05169 Epstein-Barr virus infection
    107509910 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107509910 (MAPK8)
   05142 Chagas disease
    107509910 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107509910 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107509910 (MAPK8)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107509910 (MAPK8)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107509910 (MAPK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 107509910
NCBI-ProteinID: XP_015998337
LinkDB
Position
Unknown
AA seq 427 aa
MSRSKRDSNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVISGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacagcaatttttatagtgtagagattggtgattctacattc
acagtcctgaaacgatatcagaatttaaaacctataggctcaggagctcaaggaatagta
tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccggccg
tttcagaatcagactcatgctaagcgggcttacagagaactagttcttatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatcactagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggaactagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcactctgctggaattattcatcgggacttaaagcccagtaatatagtagtaaaa
tcagactgcactttgaagattcttgactttggactggccaggactgctggaactagtttt
atgatgacaccttatgtagtgactcgctactacagagcaccagaagtcatcctaggaatg
ggctacaaagaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag
cttggaacaccatgtcccgaattcatgaagaaactacaaccaacagtaaggacttacgtt
gaaaacagacctaaatatgctggatatagctttgagaaactcttccctgatgtacttttc
ccagctgattcggaacacaacaaacttaaagccagtcaggcaagggatttgttatctaaa
atgctggttattgatgcatctaaaaggatctctgtagatgaagctctccagcatccatat
atcaatgtctggtatgatccttctgaagcagaagctccaccaccaaagatacctgacaag
caattagatgaaagggaacacacaatagaagagtggaaagaattgatatacaaggaagtt
atggacttggaggagagaaccaagaatggagttatacggggacagccctctcctttaggt
gcagcagtgatcagtggctctcagcatccatcgtcatcgtcgtctgtcaatgatgtatct
tcaatgtcaacagacccgactttggcctcggatacagacagcagtctagaagcatcagct
ggacctctgggctgctgtagatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107512328
Entry
107512328         CDS       T06036                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04024  cAMP signaling pathway
ray04068  FoxO signaling pathway
ray04071  Sphingolipid signaling pathway
ray04137  Mitophagy - animal
ray04140  Autophagy - animal
ray04141  Protein processing in endoplasmic reticulum
ray04210  Apoptosis
ray04215  Apoptosis - multiple species
ray04217  Necroptosis
ray04310  Wnt signaling pathway
ray04380  Osteoclast differentiation
ray04510  Focal adhesion
ray04530  Tight junction
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04657  IL-17 signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04660  T cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04668  TNF signaling pathway
ray04722  Neurotrophin signaling pathway
ray04723  Retrograde endocannabinoid signaling
ray04728  Dopaminergic synapse
ray04750  Inflammatory mediator regulation of TRP channels
ray04910  Insulin signaling pathway
ray04912  GnRH signaling pathway
ray04914  Progesterone-mediated oocyte maturation
ray04917  Prolactin signaling pathway
ray04920  Adipocytokine signaling pathway
ray04926  Relaxin signaling pathway
ray04930  Type II diabetes mellitus
ray04931  Insulin resistance
ray04932  Non-alcoholic fatty liver disease
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04935  Growth hormone synthesis, secretion and action
ray05010  Alzheimer disease
ray05012  Parkinson disease
ray05016  Huntington disease
ray05017  Spinocerebellar ataxia
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
ray05133  Pertussis
ray05135  Yersinia infection
ray05142  Chagas disease
ray05145  Toxoplasmosis
ray05152  Tuberculosis
ray05161  Hepatitis B
ray05162  Measles
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05210  Colorectal cancer
ray05212  Pancreatic cancer
ray05231  Choline metabolism in cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107512328 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107512328 (MAPK9)
   04012 ErbB signaling pathway
    107512328 (MAPK9)
   04014 Ras signaling pathway
    107512328 (MAPK9)
   04310 Wnt signaling pathway
    107512328 (MAPK9)
   04668 TNF signaling pathway
    107512328 (MAPK9)
   04068 FoxO signaling pathway
    107512328 (MAPK9)
   04071 Sphingolipid signaling pathway
    107512328 (MAPK9)
   04024 cAMP signaling pathway
    107512328 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107512328 (MAPK9)
   04137 Mitophagy - animal
    107512328 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    107512328 (MAPK9)
   04215 Apoptosis - multiple species
    107512328 (MAPK9)
   04217 Necroptosis
    107512328 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107512328 (MAPK9)
   04530 Tight junction
    107512328 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107512328 (MAPK9)
   04621 NOD-like receptor signaling pathway
    107512328 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    107512328 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    107512328 (MAPK9)
   04660 T cell receptor signaling pathway
    107512328 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    107512328 (MAPK9)
   04659 Th17 cell differentiation
    107512328 (MAPK9)
   04657 IL-17 signaling pathway
    107512328 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    107512328 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107512328 (MAPK9)
   04920 Adipocytokine signaling pathway
    107512328 (MAPK9)
   04912 GnRH signaling pathway
    107512328 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    107512328 (MAPK9)
   04917 Prolactin signaling pathway
    107512328 (MAPK9)
   04926 Relaxin signaling pathway
    107512328 (MAPK9)
   04935 Growth hormone synthesis, secretion and action
    107512328 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    107512328 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    107512328 (MAPK9)
   04722 Neurotrophin signaling pathway
    107512328 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107512328 (MAPK9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107512328 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107512328 (MAPK9)
   05231 Choline metabolism in cancer
    107512328 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107512328 (MAPK9)
   05212 Pancreatic cancer
    107512328 (MAPK9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107512328 (MAPK9)
   05012 Parkinson disease
    107512328 (MAPK9)
   05016 Huntington disease
    107512328 (MAPK9)
   05017 Spinocerebellar ataxia
    107512328 (MAPK9)
   05020 Prion disease
    107512328 (MAPK9)
   05022 Pathways of neurodegeneration - multiple diseases
    107512328 (MAPK9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107512328 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107512328 (MAPK9)
   04932 Non-alcoholic fatty liver disease
    107512328 (MAPK9)
   04931 Insulin resistance
    107512328 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107512328 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107512328 (MAPK9)
   05135 Yersinia infection
    107512328 (MAPK9)
   05133 Pertussis
    107512328 (MAPK9)
   05152 Tuberculosis
    107512328 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107512328 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    107512328 (MAPK9)
   05161 Hepatitis B
    107512328 (MAPK9)
   05171 Coronavirus disease - COVID-19
    107512328 (MAPK9)
   05162 Measles
    107512328 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107512328 (MAPK9)
   05169 Epstein-Barr virus infection
    107512328 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107512328 (MAPK9)
   05142 Chagas disease
    107512328 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107512328 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107512328 (MAPK9)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107512328 (MAPK9)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107512328 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 107512328
NCBI-ProteinID: XP_016003242
LinkDB
Position
Unknown
AA seq 424 aa
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSADFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVSSHATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagtgacagtaaatgtgatagtcagttttacagtgtgcaagtggcagactcaactttc
actgtcctaaaacgttaccagcagttgaaaccgattggctctggagcccaaggaattgtt
tgtgctgctttcgataccgttcttggaataaatgttgcagtcaagaaactaagtcggcct
tttcagaatcaaactcatgcaaagagagcctatcgtgaacttgtcctcctaaaatgtgtc
aatcataaaaatatcattagtttgttaaatgtgtttacaccacaaaaaactctagaagaa
tttcaagatgtgtacttggttatggaattaatggatgctaacttatgtcaggttattcat
atggagttggaccatgaaagaatgtcctaccttctttaccagatgctctgtggtattaaa
catttgcattcagctggtatcatccatagagatttgaaacctagcaacattgtagtgaag
tcagactgcacccttaagatcttggactttggcctagcccggaccgcatgcaccaacttt
atgatgactccctatgtggtgacacggtattaccgggctcccgaagtcatcctgggcatg
ggctacaaagagaatgttgatatctggtcagtgggttgcatcatgggcgagctggtgaaa
ggttgtgtgatattccaaggcactgaccatattgatcaatggaataaagttattgagcag
ctaggaacaccatctgcagatttcatgaagaaacttcagccaactgtgaggaattatgta
gaaaacagaccaaagtatcctggaatcaaatttgaagaactctttccagattggatattc
ccatcagaatcagaacgagacaaaattaaaacaagtcaagccagagatttgttatcgaaa
atgttagtgatagaccctgataagcgcatctccgtggatgaagctttgcgtcacccttac
atcaccgtctggtatgaccctgcagaagcagaagcgccaccacctcagatttacgatgcc
cagttggaagaaagagaacatgcgattgaagaatggaaagagctaatttacaaagaagtc
atggattgggaagagagaagcaagaatggtgttgtaaaagatcagccttcagatgcagca
gtgagcagccacgccactccttctcagtcgtcatctatcaatgacatttcatccatgtcc
actgagcagacgctggcctcagacacagacagcagtctcgacgcctcgaccggacccctt
gaaggttgtcgatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515392
Entry
107515392         CDS       T06036                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04024  cAMP signaling pathway
ray04068  FoxO signaling pathway
ray04071  Sphingolipid signaling pathway
ray04137  Mitophagy - animal
ray04140  Autophagy - animal
ray04141  Protein processing in endoplasmic reticulum
ray04210  Apoptosis
ray04215  Apoptosis - multiple species
ray04217  Necroptosis
ray04310  Wnt signaling pathway
ray04380  Osteoclast differentiation
ray04510  Focal adhesion
ray04530  Tight junction
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04657  IL-17 signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04660  T cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04668  TNF signaling pathway
ray04722  Neurotrophin signaling pathway
ray04723  Retrograde endocannabinoid signaling
ray04728  Dopaminergic synapse
ray04750  Inflammatory mediator regulation of TRP channels
ray04910  Insulin signaling pathway
ray04912  GnRH signaling pathway
ray04914  Progesterone-mediated oocyte maturation
ray04917  Prolactin signaling pathway
ray04920  Adipocytokine signaling pathway
ray04926  Relaxin signaling pathway
ray04930  Type II diabetes mellitus
ray04931  Insulin resistance
ray04932  Non-alcoholic fatty liver disease
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04935  Growth hormone synthesis, secretion and action
ray05010  Alzheimer disease
ray05012  Parkinson disease
ray05016  Huntington disease
ray05017  Spinocerebellar ataxia
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
ray05133  Pertussis
ray05135  Yersinia infection
ray05142  Chagas disease
ray05145  Toxoplasmosis
ray05152  Tuberculosis
ray05161  Hepatitis B
ray05162  Measles
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05210  Colorectal cancer
ray05212  Pancreatic cancer
ray05231  Choline metabolism in cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107515392 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107515392 (MAPK10)
   04012 ErbB signaling pathway
    107515392 (MAPK10)
   04014 Ras signaling pathway
    107515392 (MAPK10)
   04310 Wnt signaling pathway
    107515392 (MAPK10)
   04668 TNF signaling pathway
    107515392 (MAPK10)
   04068 FoxO signaling pathway
    107515392 (MAPK10)
   04071 Sphingolipid signaling pathway
    107515392 (MAPK10)
   04024 cAMP signaling pathway
    107515392 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107515392 (MAPK10)
   04137 Mitophagy - animal
    107515392 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    107515392 (MAPK10)
   04215 Apoptosis - multiple species
    107515392 (MAPK10)
   04217 Necroptosis
    107515392 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107515392 (MAPK10)
   04530 Tight junction
    107515392 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107515392 (MAPK10)
   04621 NOD-like receptor signaling pathway
    107515392 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    107515392 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    107515392 (MAPK10)
   04660 T cell receptor signaling pathway
    107515392 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    107515392 (MAPK10)
   04659 Th17 cell differentiation
    107515392 (MAPK10)
   04657 IL-17 signaling pathway
    107515392 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    107515392 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107515392 (MAPK10)
   04920 Adipocytokine signaling pathway
    107515392 (MAPK10)
   04912 GnRH signaling pathway
    107515392 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    107515392 (MAPK10)
   04917 Prolactin signaling pathway
    107515392 (MAPK10)
   04926 Relaxin signaling pathway
    107515392 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    107515392 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    107515392 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    107515392 (MAPK10)
   04722 Neurotrophin signaling pathway
    107515392 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107515392 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107515392 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107515392 (MAPK10)
   05231 Choline metabolism in cancer
    107515392 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107515392 (MAPK10)
   05212 Pancreatic cancer
    107515392 (MAPK10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107515392 (MAPK10)
   05012 Parkinson disease
    107515392 (MAPK10)
   05016 Huntington disease
    107515392 (MAPK10)
   05017 Spinocerebellar ataxia
    107515392 (MAPK10)
   05020 Prion disease
    107515392 (MAPK10)
   05022 Pathways of neurodegeneration - multiple diseases
    107515392 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107515392 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107515392 (MAPK10)
   04932 Non-alcoholic fatty liver disease
    107515392 (MAPK10)
   04931 Insulin resistance
    107515392 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107515392 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107515392 (MAPK10)
   05135 Yersinia infection
    107515392 (MAPK10)
   05133 Pertussis
    107515392 (MAPK10)
   05152 Tuberculosis
    107515392 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107515392 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    107515392 (MAPK10)
   05161 Hepatitis B
    107515392 (MAPK10)
   05171 Coronavirus disease - COVID-19
    107515392 (MAPK10)
   05162 Measles
    107515392 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107515392 (MAPK10)
   05169 Epstein-Barr virus infection
    107515392 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107515392 (MAPK10)
   05142 Chagas disease
    107515392 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107515392 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107515392 (MAPK10)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107515392 (MAPK10)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107515392 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 107515392
NCBI-ProteinID: XP_016009617
LinkDB
Position
Unknown
AA seq 464 aa
MSLHLLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNVISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDMWSVGCIMGEMIKGAVLFPGTDHIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgagcctccatttattatactactgcagtgaaccaaccttggatgtgaaaattgccttt
tgtcagggtttcgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagttgacaaccaattctacagtgtggaagtgggagactcaaccttcacagtt
ctcaagcgctaccagaatctaaagcctattggctctggggctcagggaatagtttgtgct
gcgtatgatgctgtccttgacagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaacacatgccaagagagcttaccgggaactggtcctcatgaaatgtgtgaaccat
aaaaacgttattagtttattaaatgtcttcacaccccagaaaacgctggaggagttccaa
gatgtttatttagtaatggaactgatggatgccaacttgtgtcaggtgattcagatggaa
ttagaccatgagcgaatgtcttaccttctttaccaaatgttgtgtggcatcaaacacctc
cactctgctggaattattcacagggatttaaaaccaagtaacattgtagtcaagtctgat
tgtacattgaaaatcctcgactttggactggccaggacggcaggcacaagcttcatgatg
actccttatgtggtgacacgttattacagagcccctgaggtcatcttgggcatgggctac
aaggagaacgttgacatgtggtcagtagggtgcatcatgggagaaatgataaaaggtgca
gtgctgtttcctggcactgatcatattgaccagtggaacaaggtaattgagcaactagga
acaccatgtccggagttcatgaagaaattgcaacccacagtaagaaactatgtggagaat
cggcccaagtatgctggactcaccttccccaagctctttccagattccctcttcccagcg
gattccgagcacaataaactcaaagccagccaagccagggacttattgtcaaagatgcta
gtcattgacccagccaaaaggatatcagtggatgacgctttacagcacccatatatcaac
gtctggtatgaccctgctgaagtggaggcgcctccacctcagatatatgacaaacagttg
gatgaaagagaacacaccattgaagaatggaaagaacttatctacaaggaagtaatgaat
tcagaagaaaagactaaaaatggtgtcgtaaaaggacaaccttctccttcaggtgcagca
gtgaacagcagtgagagtctccctccatcctcgtccgtcaatgacatctcttccatgtcc
actgaccagaccctggcatctgacactgacagcagcctggaagcctcggcgggacccctg
ggttgttgcaggtga

DBGET integrated database retrieval system