KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509975
Entry
107509975         CDS       T06036                                 

Gene name
CNGA3
Definition
(RefSeq) cyclic nucleotide-gated cation channel alpha-3
  KO
K04950  cyclic nucleotide gated channel alpha 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04024  cAMP signaling pathway
ray04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107509975 (CNGA3)
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107509975 (CNGA3)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   107509975 (CNGA3)
SSDB
Motif
Pfam: Ion_trans CLZ cNMP_binding Ion_trans_2
Other DBs
NCBI-GeneID: 107509975
NCBI-ProteinID: XP_015998485
LinkDB
Position
Unknown
AA seq 668 aa
MAKVITQYSHPNTTHPAVRTTDGELGHIENGLSRTHLPCEETSELQQGIAMETSGRAGSG
RGSFTGLGPARLWSHIVSLRVWATRHLHSQDRRRRLDSFLERFQGAELKEVSSRGSNAQC
DVSGQEPDRGRRKKDTIVVDPASNAYYHWLTVIALPVFYNWCLLVCRACFDELQSEHLML
WLVLDYSADVLYGLDMLVRARTGFLEQGLMVRDGKRLWQHYMKTLYFKLDVLALVPTDLA
YLKLGVNYPELRFNRLLKLTRLFEFFDRTETRTNYPNVFRIGNLVLYILVIIHWNACIYF
AISKFIGFGTDSWVYPNISNPEYGRLSRKYIYSLYWSTLTLTTIGETPPPVRDGEYLFVV
VDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLETRVIRWFD
YLWANKKTVDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPAV
FSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGN
RRTASIRSLGYSDLFCLSKDDLMEALTEYPDAKKALEEKGRQILMKDNLIDEDLAKAGPD
PKDLEEKVEYLEFSLDALQTRFSRLLAEYNATQMKVKQRLSHLESQVKVGGSSPLPDGDT
PESETKQQ
NT seq 2007 nt   +upstreamnt  +downstreamnt
atggccaaggttattacacagtattcccaccccaacacgacccaccctgcggtgaggacc
acagacggagagctaggtcacattgaaaatggcctcagcaggacccacttgccatgtgaa
gagacatcagaactgcagcaagggatcgccatggagaccagtggacgggctggatctggg
cgaggctccttcaccggcctggggcctgccaggttgtggagccacattgtctcgcttcgc
gtgtgggccaccaggcacttacactctcaggaccggagacggagactcgactctttcctg
gagcgtttccaaggagctgagctcaaggaggtgtccagcagaggaagcaatgcccagtgc
gacgtgagcggccaagagccagacagagggaggagaaagaaggacaccattgtggtagac
cctgccagcaacgcatactaccactggctgaccgtcatcgccctgcctgtcttctacaac
tggtgtctgctggtctgcagggcctgttttgatgagctgcaatctgaacacctgatgctg
tggctggtcctggactactcggcggatgtcctctatggcttggatatgttggtgcgagcc
cggacaggcttcctcgagcaaggcttgatggtgagggatggcaagagactgtggcagcat
tacatgaagaccttgtacttcaagctggacgtgttggccttggtccccacagacctggct
tatttgaagctgggtgtaaactacccagaactgaggttcaaccgcctactgaagttgacc
cggctctttgagttcttcgaccgcacagagacgaggaccaattatcccaatgtgttcagg
attgggaacctggtcttgtacatcctcgtcatcatccactggaatgcctgcatctacttc
gccatttccaagttcatcggttttgggacagattcctgggtgtacccaaacatctcaaac
ccagagtatgggcgcctctccaggaagtacatttatagcctctactggtccaccttgacc
ctgaccactattggtgaaacacctcctcctgtgagagatggggagtacctctttgtggtc
gtagacttcctggtgggtgtcttgatttttgctaccatcgtggggaatgtgggctccatg
atctcgaacatgaacgcctcacgggctgagttccaggccaagattgactccatcaagcag
tacatgcagttccgcaaggtgaccaaggatttggagacacgggtcatccggtggtttgac
tacctgtgggccaacaagaagacggtggatgagaaggaagtgctcaagagcctcccagac
aagctgaaggccgaaattgccatcaacgtgcacctggacaccctgaagaaggtccgcatc
ttccaggactgtgaggcagggctgctggtggagctcgtgctgaagctgcggcctgcggtg
ttcagccctggggactacatctgcaagaagggggacatcgggagggagatgtacatcatt
aaggagggcaagctggccgtggtagccgatgacggggtcactcagttcgtggtgctcagc
gatgggagctactttggggagatcagcatcctgaacatcaagggcagcaagtcagggaac
cgtcggacagccagtatccggagccttggctactcagacctgttttgtctttccaaggat
gacctaatggaggcactcactgaataccctgatgccaaaaaggccctggaggagaagggg
aggcagattcttatgaaggacaacctgattgatgaggacctggccaaggccggaccagac
cccaaggacctcgaggagaaggtagagtacctggagttctccctggacgccctgcagacc
aggttctcacggctcctagccgagtacaatgccacccagatgaaggtgaagcagcgtctc
agccacctggaaagccaggtgaaggtcggtgggagcagccctctacctgatggggacacc
ccagaatcagagaccaaacaacagtga

DBGET integrated database retrieval system