KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510212
Entry
107510212         CDS       T06036                                 

Gene name
ITGB2
Definition
(RefSeq) integrin beta-2 isoform X1
  KO
K06464  integrin beta 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04015  Rap1 signaling pathway
ray04145  Phagosome
ray04390  Hippo signaling pathway
ray04514  Cell adhesion molecules
ray04610  Complement and coagulation cascades
ray04613  Neutrophil extracellular trap formation
ray04650  Natural killer cell mediated cytotoxicity
ray04670  Leukocyte transendothelial migration
ray04810  Regulation of actin cytoskeleton
ray05133  Pertussis
ray05134  Legionellosis
ray05140  Leishmaniasis
ray05144  Malaria
ray05146  Amoebiasis
ray05150  Staphylococcus aureus infection
ray05152  Tuberculosis
ray05166  Human T-cell leukemia virus 1 infection
ray05323  Rheumatoid arthritis
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107510212 (ITGB2)
   04390 Hippo signaling pathway
    107510212 (ITGB2)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107510212 (ITGB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107510212 (ITGB2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107510212 (ITGB2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    107510212 (ITGB2)
   04613 Neutrophil extracellular trap formation
    107510212 (ITGB2)
   04650 Natural killer cell mediated cytotoxicity
    107510212 (ITGB2)
   04670 Leukocyte transendothelial migration
    107510212 (ITGB2)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    107510212 (ITGB2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107510212 (ITGB2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    107510212 (ITGB2)
   05134 Legionellosis
    107510212 (ITGB2)
   05150 Staphylococcus aureus infection
    107510212 (ITGB2)
   05152 Tuberculosis
    107510212 (ITGB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107510212 (ITGB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107510212 (ITGB2)
   05144 Malaria
    107510212 (ITGB2)
   05140 Leishmaniasis
    107510212 (ITGB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107510212 (ITGB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107510212 (ITGB2)
   04515 Cell adhesion molecules [BR:ray04515]
    107510212 (ITGB2)
   04090 CD molecules [BR:ray04090]
    107510212 (ITGB2)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    107510212 (ITGB2)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107510212 (ITGB2)
Cell adhesion molecules [BR:ray04515]
 Integrins
  Integrin beta subunits
   107510212 (ITGB2)
CD molecules [BR:ray04090]
 Proteins
  107510212 (ITGB2)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin EGF_2 I-EGF_1 PNTB_4TM
Other DBs
NCBI-GeneID: 107510212
NCBI-ProteinID: XP_015999015
LinkDB
Position
Unknown
AA seq 989 aa
MWSVERLLSLLTCDLRSVPLSPSPPLRASPSVLAALSVRRQDRRNLAAGPPLPEGTQELQ
PGPPRGLARPWPVSSAGCPPPSGLPRAQGWSQGTRSSASSLPPLSSRCPPAPRHLCDRVW
APRTPVRRSWEGCAPPWGAQAAGRSRLSGTPSQEASRLHHQGLGWPASSQPCHRPSRLQS
GQKPRGPCQRVGRPCRGLRLSSADMPCQRFPLLALAGLLSLGSVLSQECPKYKVGTCQDC
IQSGPGCAWCQKLNFTGPSEPDSIRCDTREQLLSKGCAADDIMDPRSLAQPQKDEDRGRK
QQLSPQRVRVYLRPGQAAVFNVTFRRAKGYPIDLYYLMDLSYSMLDDLINVKKLGGDLLQ
ALNEITESGRIGFGSFVDKTVLPFVNTHPEKLKNPCPNKEKQCQPPFAFRHVLKLTDNSN
QFQTEVGKQLISGNLDAPEGGLDAMMQVAACPKEIGWRNVTRLLVFATDDGFHIAGDGKL
GAILTPNDGRCHLEDNMYKRSNEFDYPSVGQLAHKLAESNIQPIFAVTKRMVKTYEKLTE
IIPKSAVGELSEDSSNVVQLIKNAYNKLSSRVFLEHNTLPDTLKVTYDSFCSNGVSQVNQ
PRGDCDGVQINNPVTFQVKVTAAECIPETSFVIRALGFSDTVTVQALPQCACHCRDVGRD
RGLCLNKGSVECGICRCDAGYTGKNCECQTQGRSSQELEGNCRKDNVSVICSGLGDCICG
QCVCHASDVPGRKVFGQFCECDNFNCERYGGHVSAAPLSRGGPGRGECSCGKCLCKEGFG
GSACQCEKSSDGCRNVRGAVCSGRGQCLCNACTCNTGYQLPFCEDCPGCHSPCGKLVSCA
ECLKFDKGPLEKNCSRACANLTLLSSAPEPGRLAHPGLTRRCRERDSEGCWLNYTLWQQD
GMDKYSVLVDEQRECPEGPNVAAIVGGTVAGVVLIGVLLLVIWKALTHLSDLREYKRFEK
EKLKSQWNNENPLFKSATTTVMNPKFAES
NT seq 2970 nt   +upstreamnt  +downstreamnt
atgtggtcggtggagaggctcttgagtctcttaacctgtgacctgcgcagtgtccccctg
tccccctcgccccctctccgtgcctctccctctgtcctcgctgccttgtctgtgcggcga
caggacaggaggaacctcgctgcaggcccgccgcttcccgagggcacacaggagctccag
ccgggtcctccccggggtctggcacgtccgtggcctgtgtcctctgccggctgccctcct
ccctccggcctcccgcgggcacagggctggtcacagggcacccgcagctctgccagctcc
ctgcccccactctccagccgctgcccccctgctcctcgccatctctgtgaccgagtatgg
gcccccaggacccctgttcgccgctcctgggaagggtgcgcgccaccgtggggcgctcag
gctgcgggccggtcccgtctctcgggcactccctcccaggaagcatcgcgtcttcaccat
caggggctcggctggccggcgtcgtcccagccgtgccacagacccagccggctgcagagt
gggcagaagcccagaggcccctgccagcgagtcggacgcccctgccgcggcctcaggctg
tcaagcgcggacatgccgtgtcaacgcttcccgctgctggccctggcgggtctgctgtcc
ctcgggtctgtgctctcccaggagtgccccaagtacaaggtcggcacctgccaggactgc
atccagtcggggcccggctgcgcctggtgtcagaagctgaatttcacaggacccagcgag
cccgactccattcgctgtgacacacgggagcagctactgtctaagggctgtgccgctgac
gatatcatggaccccaggagcctggcccagccccagaaggacgaggacaggggcaggaag
cagcagctgtccccacagagagtgagggtctacctgagaccaggccaggcggcggtattc
aacgtgaccttccgccgcgccaagggctaccccatcgacctgtactacctgatggacctc
tcctactccatgctcgacgacctcatcaacgtcaaaaagctggggggcgacctgctccag
gccctcaacgagatcacggagtctggccgcattggcttcgggtccttcgtggacaagacg
gtgctccccttcgtcaacacgcaccccgagaagctgaagaacccgtgccccaacaaggag
aagcagtgccagcccccgttcgccttccggcacgtgctgaagctcaccgacaactccaac
cagtttcagacggaggtcggcaagcagctgatctccgggaacctggacgcccccgagggc
gggctggacgccatgatgcaggtggccgcgtgcccgaaggaaattggctggcgcaacgtc
acgcgcctgctggtgtttgccacggacgacggcttccacattgcgggggacgggaaactg
ggcgccatcctgacccccaatgacggccgctgccacttggaggacaatatgtacaagaga
agcaatgagtttgactacccgtcggtcggccagctggcgcacaaactggccgagagcaac
atccagcccatcttcgccgtgaccaagaggatggtgaaaacctacgagaagctcactgag
atcatccccaagtcggcggtcggggagctgtccgaggactccagcaacgtggtccagctc
atcaagaatgcctacaacaaactgtcctcccgcgtctttctggagcacaacaccctcccc
gacaccctgaaagtcacctacgactccttctgcagtaacggagtatcgcaggtgaaccag
cccagaggggactgtgacggcgtccagatcaacaacccggtcaccttccaggtgaaggtc
acggccgcagagtgcatcccggagacgtcgttcgtcatccgggcgctgggcttctcggac
acggtgaccgtgcaggcccttccccagtgcgcatgccactgccgcgacgtgggccgggac
cgcggcctgtgcctcaacaagggctctgtggagtgcggcatctgcaggtgcgacgccggc
tacaccggcaagaactgcgagtgccagacgcagggccgcagcagccaggagctggagggc
aactgccgcaaggacaacgtgtccgtcatctgctcggggctgggggactgcatctgcggg
cagtgcgtgtgccacgcgagcgacgtgcccggcaggaaggtcttcgggcagttctgcgag
tgcgacaacttcaactgcgagcgctacggcggccacgtgtcggcggccccgcttagccgc
ggcggccccggtcgcggggagtgctcctgcggcaagtgcctctgcaaagaggggttcggg
ggctcggcctgccagtgcgagaagtccagcgacggctgccggaacgtgcggggcgccgtg
tgcagcggccgcggccagtgcctgtgcaatgcgtgcacgtgcaacacgggctaccagctg
cccttctgcgaggactgccctggctgccactcgccctgcggcaagctcgtctcctgtgcc
gaatgcctgaagttcgacaagggccccttggagaagaactgcagccgggcctgcgcgaac
ctgacgctgctgagcagcgcgcccgagcccgggcggctcgcccacccggggctgacgcgg
cggtgcagggagcgggactcggagggctgctggctgaactacaccctgtggcagcaggac
ggcatggacaagtacagcgtgctggtggacgagcagcgagagtgtccagagggccccaac
gttgctgccattgtggggggcaccgtggcgggagtcgtgctgatcggggtcctcctgctg
gtcatctggaaagcgctgacgcacctgagtgacctcagggagtacaagcgcttcgagaag
gagaagctcaagtctcagtggaacaacgaaaaccccctttttaagagcgccaccacgacg
gtcatgaaccctaagtttgctgagagttag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515868
Entry
107515868         CDS       T06036                                 

Gene name
ITGAL
Definition
(RefSeq) integrin alpha-L isoform X1
  KO
K05718  integrin alpha L
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04015  Rap1 signaling pathway
ray04514  Cell adhesion molecules
ray04613  Neutrophil extracellular trap formation
ray04650  Natural killer cell mediated cytotoxicity
ray04670  Leukocyte transendothelial migration
ray04810  Regulation of actin cytoskeleton
ray05144  Malaria
ray05150  Staphylococcus aureus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05169  Epstein-Barr virus infection
ray05323  Rheumatoid arthritis
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107515868 (ITGAL)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107515868 (ITGAL)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107515868 (ITGAL)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107515868 (ITGAL)
   04650 Natural killer cell mediated cytotoxicity
    107515868 (ITGAL)
   04670 Leukocyte transendothelial migration
    107515868 (ITGAL)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    107515868 (ITGAL)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107515868 (ITGAL)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107515868 (ITGAL)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107515868 (ITGAL)
   05169 Epstein-Barr virus infection
    107515868 (ITGAL)
  09174 Infectious disease: parasitic
   05144 Malaria
    107515868 (ITGAL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107515868 (ITGAL)
   04515 Cell adhesion molecules [BR:ray04515]
    107515868 (ITGAL)
   04090 CD molecules [BR:ray04090]
    107515868 (ITGAL)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107515868 (ITGAL)
Cell adhesion molecules [BR:ray04515]
 Integrins
  Integrin alpha subunits
   107515868 (ITGAL)
CD molecules [BR:ray04090]
 Proteins
  107515868 (ITGAL)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS FG-GAP_2 Integrin_alpha
Other DBs
NCBI-GeneID: 107515868
NCBI-ProteinID: XP_016010585
LinkDB
Position
Unknown
AA seq 1170 aa
MNSCIILMRLLLSGPFLFAPASGYNLDVRHVQNLSIPHAGRHFGYRVLQVGNGVVVGAPG
EGSSMGNLYQCQRGTGPCLPVSLSGSNYTSKYLGMTLATDPANGRLLVCDPGLSRTCDQN
IYLSGLCYLFHQDLRGPVLQGRPGYQECLKGNVDLVFLFDGSLSLQQNEFQKILDFMKDV
MKKLSNSSYQFAAVQFSSTFKTEFNFLDYVKLKNPDLLLAKVKHMRELTNTFGAINYVAN
NVFQQDLGARPDATKVLIIITDGEATDKENIDAAKDIVRYIIGIGKHFTTNKSQETLHEF
ASKPAEEFVKILDTFEKLKDLFTELQKKIYVIEGTDKQDLTSFNMELSSSGISADLSRDH
GIVGAVGAKDWAGGFLDLKADLQDDIFVGNEPLTTEVRAGYLGYTVTWLPSLWSTSMLAV
GAPRYQHVGRVLLFQESKGKGQWSQIQKIDGIQIGSYFGGELCGIDMDQDGETELLLIGA
PLFYGEQRGGRVFIYRKKKLGFEAELPELQGDPGYPLGRFGSAIAALADINGDKLMDVAV
GAPLEEQGAVYIFNGCRDRLSRRPSQRIEGTQVFPGIRWFGRSIHGVKDLGGDNLTDVAV
GAEGQVIVLSSRPVVDIVTLMSFSPAEIPVHEVECSYSTSNKKKEGVNVTVCFQVKSVTS
QFQGLLIANLTYTLQLDGHRTRSRGLFPGERHELSGNTLVTSDKSCTKFWFHFPVCVQDL
ISPINVSLNFSLWEEEGTLRSQSAQGKNIQPILTPLPHSETKEIPFEKNCGEDKNCEANL
GLSFSPARSTVLHLTPSASLSMELTLNNLGEDAYWVQLSLSLPRGLSFRKVETLKPHSQI
PVSCEELPEEATLPARNLSCNVSSPIFKAGSSIVIQVMFYTVMNSSWGDFVKLHANVRCD
NENASLLEDNSAATSIPVLYPINILTEGQENSTAYISFTSKGPKIHHVKHIYQVRIQPSV
HDHNVPTLEALIGVPQPHSEGLITQKWSVQMEPPVICHKENLERSPSVTEQPCLPGALFH
CPVVFKQEILIQVTGTVELVGEIKASSMFSLCSSLSVSFNSSKHFHLYGSNSSLAQVIMK
VDIVYEKEMLYLYVLSSIAGLLLLLLIFLVLYKVGFFKRGLKEKMEATVDASNGSPGEDS
GKPASEEEAVDPGCLDPLHKEDAQDGGGTI
NT seq 3513 nt   +upstreamnt  +downstreamnt
atgaactcctgcatcatcttaatgaggctgctgctgtctgggccttttctctttgccccg
gcctccggctacaacctggacgtgcgtcatgtgcagaacttgtccatcccacacgcgggg
aggcattttgggtaccgcgtcctgcaggttggaaatggggttgtcgtgggagctccgggt
gaggggagcagcatgggaaatctctaccagtgccagcgaggcactggaccctgcctgcca
gtgagcctgagtggttcaaactacacttctaagtacttgggaatgaccttggcgacagac
cctgcaaatggaagacttttggtctgtgaccctgggctgtctcggacatgtgatcagaat
atctatctaagtggtctgtgctacctcttccaccaggatctgaggggtcctgtgctgcaa
gggcgccctggctatcaggaatgtctaaagggcaatgtagacctggtatttttgttcgat
ggttcattgagcttgcagcaaaatgaatttcagaaaattctggacttcatgaaggatgtg
atgaagaaactcagcaattcttcctaccagtttgctgctgttcagttttcctcgaccttc
aaaacagaatttaatttcttggattatgttaaactgaagaaccccgatctcctgctggcc
aaagtaaaacacatgcgcgagttgaccaacacctttggtgccatcaactatgtggcgaac
aatgtattccagcaagacctgggggcccggccagatgccaccaaagtgctcatcatcatc
actgatggggaagccaccgacaaagaaaacattgacgcggccaaagacatcgtccgttac
attattgggattggaaagcatttcacaaccaataaaagtcaggagacgctgcatgaattt
gcttcaaaacccgcagaagagtttgtaaagattctggatacatttgagaaacttaaagat
ctattcactgagctgcaaaagaagatctatgttattgagggcacagacaaacaggacctg
acatccttcaacatggagctgtcctctagtggcatcagcgccgacctcagcagagaccat
ggcattgtgggggcagttggagccaaggactgggctgggggctttctagatctgaaggcg
gaccttcaggatgatatatttgttgggaatgaaccactgacaacagaagtgagagcagga
tatttgggttacactgtgacctggctaccctccctatggtccacatcaatgctggcagtt
ggagcccccagataccagcatgtgggtcgggtactgttgttccaagagtcaaaaggcaaa
ggacagtggagccagatccagaaaatagatgggatccagattggctcttattttggtggt
gagctatgtggcattgacatggaccaagatggggagacagagctgctgctgattggagcc
cccctattctatggagagcagagaggaggccgggtgttcatctatcggaaaaaaaagctg
gggtttgaagcagaactcccagaactacagggagatcctggctacccccttgggcgattt
ggatccgccatcgctgccctggcagacatcaatggggataagctgatggacgtggctgtg
ggagcccctctagaggaacagggggctgtatacatcttcaatgggtgccgtgacaggctg
agccgccggccaagtcagcggatagaaggaacccaagtgttcccaggaattcgatggttt
ggacgctccatccatggggtgaaggaccttggaggggacaacctaacagatgtggctgtg
ggggctgagggtcaggtgatcgtgctgagctcccggcctgtggtggatatcgtcactctg
atgtccttctccccagccgagatccctgtgcatgaagtagagtgctcctattcaaccagc
aacaagaagaaggaaggagttaatgtcacagtttgttttcaggtcaagtctgtcacctcc
cagttccaagggctcctgattgccaacctcacttacactctgcagctggatggccatcgg
accagaagccgggggttatttccaggagagagacatgaactcagtgggaacacacttgtc
acctcagacaagtcctgcactaagttctggttccacttcccggtatgcgtccaggacctc
atctctcccatcaatgtctccttaaatttctctctctgggaggaagaagggacactgagg
agccaaagtgcgcaaggcaagaacattcagcccatcctgacacctttaccacactccgag
accaaggagatcccttttgagaagaactgtggagaggacaagaattgtgaggcaaacctg
gggctgtccttctcccctgcaaggtccacagttctgcatctgacaccctctgccagcctc
tccatggagctgacactgaataacttgggagaagatgcttactgggttcagctcagcctg
agcttacccagaggactctccttccgcaaagtggagacactaaagccccacagtcagata
cctgtgagctgcgaggagcttcctgaagaggccacgcttccagccaggaacctctcttgc
aacgtgagctctcccatctttaaagcaggcagctcgattgttatccaggtgatgttttat
acggtgatgaacagctcctggggagactttgtcaagctacacgccaatgtgcgctgtgac
aatgagaacgcaagcctcttggaggacaactcagctgccaccagcattccagtcctgtac
cccatcaacatcctcaccgagggccaggaaaactccaccgcctacatcagtttcacctcc
aagggtcccaagatccaccatgtcaagcacatctaccaggtaaggattcagccgtccgtc
catgaccacaatgtgcccaccctagaggccttgattggtgtaccacagcctcacagtgag
gggcttatcacacagaagtggagtgtgcagatggagcctcctgttatctgccacaaagag
aatctggagaggtcacccagtgtgactgagcagccttgtttgcctggagccctattccac
tgcccagttgtcttcaagcaggagatcctcatccaagtgactggaactgtggagctggtg
ggggagatcaaggcctcctccatgttcagcctctgcagctccctctctgtctccttcaac
agcagcaagcatttccacctctacggcagcaattcctccttggcccaggtcatcatgaag
gtcgacattgtatatgagaaggaaatgctctatctctacgtgctgagcagcattgcgggg
ctgttgttgctgctgctgattttcctagtgctctacaaggttggcttcttcaaacggggt
ctgaaggagaagatggaggctactgtcgatgcctccaatggaagccctggagaagactct
gggaagccagcatctgaggaagaggctgtggatccaggctgcctggatcccctccacaag
gaggatgcccaggatggaggtggcacaatctga

DBGET integrated database retrieval system