KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510279
Entry
107510279         CDS       T06036                                 

Gene name
MAP2K6
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 6 isoform X1
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04015  Rap1 signaling pathway
ray04218  Cellular senescence
ray04380  Osteoclast differentiation
ray04620  Toll-like receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04668  TNF signaling pathway
ray04750  Inflammatory mediator regulation of TRP channels
ray04912  GnRH signaling pathway
ray04935  Growth hormone synthesis, secretion and action
ray05014  Amyotrophic lateral sclerosis
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
ray05135  Yersinia infection
ray05145  Toxoplasmosis
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107510279 (MAP2K6)
   04015 Rap1 signaling pathway
    107510279 (MAP2K6)
   04668 TNF signaling pathway
    107510279 (MAP2K6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107510279 (MAP2K6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107510279 (MAP2K6)
   04664 Fc epsilon RI signaling pathway
    107510279 (MAP2K6)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107510279 (MAP2K6)
   04935 Growth hormone synthesis, secretion and action
    107510279 (MAP2K6)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107510279 (MAP2K6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107510279 (MAP2K6)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107510279 (MAP2K6)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107510279 (MAP2K6)
   05022 Pathways of neurodegeneration - multiple diseases
    107510279 (MAP2K6)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107510279 (MAP2K6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107510279 (MAP2K6)
   05135 Yersinia infection
    107510279 (MAP2K6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107510279 (MAP2K6)
   05161 Hepatitis B
    107510279 (MAP2K6)
   05163 Human cytomegalovirus infection
    107510279 (MAP2K6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107510279 (MAP2K6)
   05169 Epstein-Barr virus infection
    107510279 (MAP2K6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107510279 (MAP2K6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107510279 (MAP2K6)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     107510279 (MAP2K6)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: STE group
  STE7 family
   107510279 (MAP2K6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal CLP1_P Choline_kinase DUF4344 APH
Other DBs
NCBI-GeneID: 107510279
NCBI-ProteinID: XP_015999122
LinkDB
Position
Unknown
AA seq 334 aa
MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELG
RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINTLGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSEEFVDFTSQCLKKNSK
ERPTYPELMQHPFFTLHESKATDVASFVKLIIGD
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgtctcagtcgaaaggcaagaagcgaaaccctggccttaaaatcccaaaggaagcgttc
gagcagcctcagaccagttccacgccacctcgagatttagactccaaagcgtgcatttct
attggaaatcagaactttgaggtgaaggcggatgacctggaacctataatggaactggga
cgaggtgcgtacggggtggtggagaagatgcgacacgtgcccagcgggcagatcatggcg
gtgaagcggatccgggccacggtaaatagccaggagcagaaaaggctactgatggatttg
gatatttccatgaggacagtggactgtccttttacggtcaccttttatggcgcactcttc
cgggagggcgatgtttggatctgcatggagctcatggatacgtcgctagataaattctac
aaacaagtgattgataaaggccaaacaattccagaggacatcttagggaaaatagcagtt
tctattgtaaaagcgttagaacatttacacagtaagctgtctgtcattcatcgagatgtc
aagccttccaacgtgctgatcaatactctgggccaagtgaagatgtgcgattttggaatc
agtggctaccttgtagactccgtcgccaaaacgatcgatgcaggatgcaaaccgtacatg
gcccctgagagaataaacccagagctcaaccagaaaggctatagcgtgaagtctgacatt
tggagtctgggcataacaatgatcgagctggccatccttcggtttccctacgattcgtgg
ggaactccctttcagcagctcaaacaagtggtcgaggagccgtcaccacagctcccagca
gacaagttctccgaagagtttgttgactttacctcacagtgcttgaagaagaattccaaa
gaacggccaacgtatccagagcttatgcaacatccgtttttcaccctacatgaatccaaa
gcaacagacgtggcatcttttgtaaaactgattatcggagactaa

DBGET integrated database retrieval system