KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510298
Entry
107510298         CDS       T06036                                 

Gene name
GNA13
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-13
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04270  Vascular smooth muscle contraction
ray04371  Apelin signaling pathway
ray04611  Platelet activation
ray04730  Long-term depression
ray04810  Regulation of actin cytoskeleton
ray04928  Parathyroid hormone synthesis, secretion and action
ray05163  Human cytomegalovirus infection
ray05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107510298 (GNA13)
   04072 Phospholipase D signaling pathway
    107510298 (GNA13)
   04071 Sphingolipid signaling pathway
    107510298 (GNA13)
   04022 cGMP-PKG signaling pathway
    107510298 (GNA13)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107510298 (GNA13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107510298 (GNA13)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    107510298 (GNA13)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107510298 (GNA13)
  09156 Nervous system
   04730 Long-term depression
    107510298 (GNA13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107510298 (GNA13)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107510298 (GNA13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107510298 (GNA13)
   04031 GTP-binding proteins [BR:ray04031]
    107510298 (GNA13)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107510298 (GNA13)
  Exosomal proteins of colorectal cancer cells
   107510298 (GNA13)
GTP-binding proteins [BR:ray04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    107510298 (GNA13)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 107510298
NCBI-ProteinID: XP_015999162
LinkDB
Position
Unknown
AA seq 377 aa
MADFLPSRSVLSVCFPGCVLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESG
KSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQLNGD
KMMSFDTRSTLAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGESVKYFLDN
LEKLGEPDYIPSQQDILFARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSV
TSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV
QIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAIDTENIRLVFR
DVKDTILHDNLKQLMLQ
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggcggacttcctgccgtcgcggtccgtgctgtccgtgtgcttccccggctgcgtgctg
acgagcggcgaggccgagcagcagcgcaagtccaaggagatcgacaaatgtctgtcccgg
gagaagacctacgtgaagcggctcgtgaagatcctgctgctgggcgcgggcgagagcggc
aagtccacctttctgaagcagatgcggatcatccacgggcaggacttcgaccagcgcgcg
cgcgaggagtttcgccccaccatctacagcaacgtgatcaaaggtatgagggtgctggta
gatgctcgagagaagcttcatattccttggggagataactcaaaccaactcaacggagac
aagatgatgtcatttgacacccggtccaccctggcggcacagggaatggtggaaactcga
gtttttttacaatatcttccggctataagagcattgtgggcagacagcggcatacagaat
gcctatgaccggcgtcgagaattccagctgggcgaatctgtaaaatatttcctggataat
ttggagaaacttggagaaccagattatattccatcacaacaagatattttgtttgccaga
aggcccaccaaaggcattcatgagtacgactttgaaattaaaaatgttccttttaaaatg
gttgatgtaggtggtcaaagatcggaaagaaaacgttggtttgaatgcttcgacagtgtg
acgtcaatacttttccttgtttcctcaagtgaatttgaccaggtgcttatggaagatcga
ctgaccaatcgccttacagaatctctgaacatttttgaaaccatcgtcaataaccgggtt
ttcagcaacgtctccataattctcttcttaaacaagacagatttgcttgaggagaaagtg
caaattgtgagcatcaaagactatttcttagaatttgaaggggatccccactgcttaaga
gacgtccaaaaattcctggtggaatgtttccggaacaaacgccgggaccagcagcagaag
cccctgtaccaccacttcaccactgctatcgacacggagaacatccgcctcgttttccgc
gacgtgaaggatactatccttcacgacaacctcaagcagcttatgctacagtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521430
Entry
107521430         CDS       T06036                                 

Gene name
GNA12
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-12
  KO
K04346  guanine nucleotide-binding protein subunit alpha-12
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04270  Vascular smooth muscle contraction
ray04730  Long-term depression
ray04810  Regulation of actin cytoskeleton
ray04928  Parathyroid hormone synthesis, secretion and action
ray05163  Human cytomegalovirus infection
ray05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107521430 (GNA12)
   04072 Phospholipase D signaling pathway
    107521430 (GNA12)
   04071 Sphingolipid signaling pathway
    107521430 (GNA12)
   04022 cGMP-PKG signaling pathway
    107521430 (GNA12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107521430 (GNA12)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    107521430 (GNA12)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107521430 (GNA12)
  09156 Nervous system
   04730 Long-term depression
    107521430 (GNA12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107521430 (GNA12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107521430 (GNA12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107521430 (GNA12)
   04031 GTP-binding proteins [BR:ray04031]
    107521430 (GNA12)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   107521430 (GNA12)
GTP-binding proteins [BR:ray04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    107521430 (GNA12)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA GTP_EFTU FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 107521430
NCBI-ProteinID: XP_016021584
LinkDB
Position
Unknown
AA seq 381 aa
MSGVVRTLSRCLLPRPAGAASAGRAARGPRRGAREARRRSRDIDAGLARERRAVRRLVKI
LLLGAGESGKSTFLKQMRIIHGREFDQKALLEFRDTIFENILKGAKVLVDARDKLGIPWQ
YSENEKHGMLLMAFENSPGLPVEPATFQLYVPALSALWRDSGITEAFSRRSEFQLGESVK
YFLDNLDRIGQLNYFPSKQDILLARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQKWFQ
CFDGITSILFMVSSSEYDQVLMEDRRTNRLQESMNIFETIVNNKLFFNVSIILFLNKMDL
LVEKVKTVSIKKHFPDFRGDPHRLEDVQRHLVQCFDRKRRNRSRPLFHHFTTAIDTENIR
FVFHAVKDTILQENLKDIMLQ
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgtccggcgtggtgcggaccctcagccgctgcctgctgccgaggccggcgggggccgcg
agcgcagggcgggcggcgcggggcccgcgacgcggagcgcgcgaggcgcggcggcgcagc
cgggacatcgacgcggggctggcccgcgagcggcgcgccgtgcggcgcctggtcaagatc
ctgctgctgggcgcgggcgagagcggcaagtccaccttcctcaagcagatgcgcatcatc
cacggccgcgagttcgaccagaaggcgctgctcgagttccgcgacaccatcttcgaaaac
atcctcaagggcgccaaggtcctcgtcgacgcgcgggacaagctcggcattccctggcag
tactccgagaatgaaaagcacgggatgctgctgatggccttcgagaacagcccggggctg
cccgtggagccggccaccttccagctgtacgtgcccgccctgagcgccctgtggagggac
tcgggcatcacagaagccttcagccggaggagcgagttccagctgggcgagtcggtgaag
tacttcctggacaacttggaccggatcggccagctgaactactttcccagtaagcaggac
atcctgctggcgaggaaggccaccaagggcatcgtggagcatgactttgtcatcaagaag
atccccttcaagatggtggacgtgggcggccagcggtcccagcgccagaagtggttccag
tgcttcgacggcatcacctcgatcctgttcatggtgtcgtccagcgagtacgaccaggtg
ctcatggaggaccggcgcaccaaccggctgcaggagtccatgaacatcttcgagacgatc
gtcaacaacaagctgttcttcaacgtctccatcatcctgttcctgaacaagatggacctg
ctggtggagaaggtgaagaccgtgagcatcaagaagcacttcccggacttccggggcgac
ccgcaccggctggaggacgtccagcgccacctggtgcagtgcttcgaccggaagcggcgg
aaccgcagcaggccgctcttccaccacttcaccaccgccatcgacaccgagaacatccgc
ttcgtgttccacgcggtgaaggacaccatcctgcaggagaacctgaaggacatcatgctg
cagtga

DBGET integrated database retrieval system