KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510307
Entry
107510307         CDS       T06036                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha type isoform X1
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04066  HIF-1 signaling pathway
ray04070  Phosphatidylinositol signaling system
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04310  Wnt signaling pathway
ray04360  Axon guidance
ray04370  VEGF signaling pathway
ray04510  Focal adhesion
ray04540  Gap junction
ray04650  Natural killer cell mediated cytotoxicity
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04670  Leukocyte transendothelial migration
ray04713  Circadian entrainment
ray04720  Long-term potentiation
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04726  Serotonergic synapse
ray04727  GABAergic synapse
ray04728  Dopaminergic synapse
ray04730  Long-term depression
ray04750  Inflammatory mediator regulation of TRP channels
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04916  Melanogenesis
ray04918  Thyroid hormone synthesis
ray04919  Thyroid hormone signaling pathway
ray04921  Oxytocin signaling pathway
ray04925  Aldosterone synthesis and secretion
ray04926  Relaxin signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray04929  GnRH secretion
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04935  Growth hormone synthesis, secretion and action
ray04960  Aldosterone-regulated sodium reabsorption
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray05017  Spinocerebellar ataxia
ray05022  Pathways of neurodegeneration - multiple diseases
ray05031  Amphetamine addiction
ray05032  Morphine addiction
ray05143  African trypanosomiasis
ray05146  Amoebiasis
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05214  Glioma
ray05223  Non-small cell lung cancer
ray05225  Hepatocellular carcinoma
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107510307 (PRKCA)
   04012 ErbB signaling pathway
    107510307 (PRKCA)
   04014 Ras signaling pathway
    107510307 (PRKCA)
   04015 Rap1 signaling pathway
    107510307 (PRKCA)
   04310 Wnt signaling pathway
    107510307 (PRKCA)
   04370 VEGF signaling pathway
    107510307 (PRKCA)
   04066 HIF-1 signaling pathway
    107510307 (PRKCA)
   04020 Calcium signaling pathway
    107510307 (PRKCA)
   04070 Phosphatidylinositol signaling system
    107510307 (PRKCA)
   04072 Phospholipase D signaling pathway
    107510307 (PRKCA)
   04071 Sphingolipid signaling pathway
    107510307 (PRKCA)
   04151 PI3K-Akt signaling pathway
    107510307 (PRKCA)
   04150 mTOR signaling pathway
    107510307 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107510307 (PRKCA)
   04540 Gap junction
    107510307 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107510307 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    107510307 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    107510307 (PRKCA)
   04670 Leukocyte transendothelial migration
    107510307 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    107510307 (PRKCA)
   04929 GnRH secretion
    107510307 (PRKCA)
   04912 GnRH signaling pathway
    107510307 (PRKCA)
   04921 Oxytocin signaling pathway
    107510307 (PRKCA)
   04926 Relaxin signaling pathway
    107510307 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    107510307 (PRKCA)
   04918 Thyroid hormone synthesis
    107510307 (PRKCA)
   04919 Thyroid hormone signaling pathway
    107510307 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    107510307 (PRKCA)
   04916 Melanogenesis
    107510307 (PRKCA)
   04925 Aldosterone synthesis and secretion
    107510307 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107510307 (PRKCA)
   04270 Vascular smooth muscle contraction
    107510307 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    107510307 (PRKCA)
   04971 Gastric acid secretion
    107510307 (PRKCA)
   04972 Pancreatic secretion
    107510307 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107510307 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107510307 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    107510307 (PRKCA)
   04727 GABAergic synapse
    107510307 (PRKCA)
   04725 Cholinergic synapse
    107510307 (PRKCA)
   04728 Dopaminergic synapse
    107510307 (PRKCA)
   04726 Serotonergic synapse
    107510307 (PRKCA)
   04720 Long-term potentiation
    107510307 (PRKCA)
   04730 Long-term depression
    107510307 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    107510307 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107510307 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    107510307 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107510307 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107510307 (PRKCA)
   05206 MicroRNAs in cancer
    107510307 (PRKCA)
   05205 Proteoglycans in cancer
    107510307 (PRKCA)
   05231 Choline metabolism in cancer
    107510307 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107510307 (PRKCA)
   05214 Glioma
    107510307 (PRKCA)
   05223 Non-small cell lung cancer
    107510307 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    107510307 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    107510307 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    107510307 (PRKCA)
   05032 Morphine addiction
    107510307 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107510307 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107510307 (PRKCA)
   05161 Hepatitis B
    107510307 (PRKCA)
   05171 Coronavirus disease - COVID-19
    107510307 (PRKCA)
   05164 Influenza A
    107510307 (PRKCA)
   05163 Human cytomegalovirus infection
    107510307 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107510307 (PRKCA)
   05143 African trypanosomiasis
    107510307 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107510307 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107510307 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107510307 (PRKCA)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107510307 (PRKCA)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107510307 (PRKCA)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    107510307 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 C1_2 Kinase-like
Other DBs
NCBI-GeneID: 107510307
NCBI-ProteinID: XP_015999180
LinkDB
Position
Unknown
AA seq 719 aa
MADVFPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNAE
LRQKFEKAKLGPAGNKVISPSEDRRQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMEGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPGKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVVSQGRSPFPEPQSPQSWRCPTHPPSWREEASDPRPPQGKRLP
LPSVLWSEQGQTRPRGGCGSSVLTELSNSVAAESPPPARLNSKGGLLGVWILWTRNSWL
NT seq 2160 nt   +upstreamnt  +downstreamnt
atggctgacgttttcccggccaacgattccacggcgtctcaggacgtggccaaccgcttc
gcgcgcaaaggggcgctgagacagaagaacgtgcatgaggtgaaggaccacaaattcatc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggttcacaagaggtgccatgaa
tttgtcactttttcctgtccgggtgcggataagggacccgacactgatgaccccaggagc
aagcacaagtttaaaatccacacttacggaagccccaccttctgcgatcactgtgggtca
ctgctgtacggacttatccaccaagggatgaaatgcgacacctgcgacatgaacgtgcac
aagcagtgcgtaataaacgtccccagcctctgcgggatggaccacacagagaagcggggg
cggatctacctgaaggccgaggtcaccgacgaaaagctccacgtcacagtacgagatgca
aagaatctcatccctatggatccaaatggactctcagacccttacgtgaagctgaaactt
attcctgatcccaagaatgaaagcaaacaaaaaaccaaaaccatccgctccacactgaac
ccccagtggaatgagtcgttcaccttcaaattaaaaccttcggataaagaccgacgactg
tccgtggaaatctgggattgggatcgcacaacaaggaacgacttcatgggctccctttcc
ttcggcgtttcggagctgatgaagatgccggccagtggatggtacaagctgcttaaccaa
gaagaaggtgagtactacaacgtgcccattccagaaggagacgaagaagggaacgcggag
ctccggcagaaattcgagaaagccaagcttggccccgctggtaacaaagtaatcagtcct
tcagaagacaggagacaaccttccaacaaccttgacagggtgaagctcacggacttcaat
ttcctcatggtcctggggaaggggagttttggaaaggtgatgctggccgacaggaaggga
acagaagaactgtacgctatcaagatcctgaagaaggacgtggtgatccaggacgatgac
gtggaatgcaccatggtagagaagcgagtgctggctttgctcgacaagccgccgttcctg
acacagctgcactcctgcttccagacggtggatcggctctacttcgtcatggaatacgtc
aacggcggggacctcatgtaccacatccagcaagtaggaaaatttaaggaaccccaagca
gtattctatgcagcagagatttccattggattgttctttcttcataaacgaggaatcatt
tatagggacctgaagttagataacgtcatgctggattcggaagggcacatcaagatcgcc
gacttcgggatgtgcaaggagcacatgatggagggagtcacaaccaggaccttctgcggg
accccagactacatcgccccggagataatcgcttatcagccgtacgggaaatctgtggac
tggtgggcctacggcgtcctgttatatgaaatgctggctgggcagcccccattcgatggt
gaagatgaagacgagctgtttcagtctataatggagcacaacgtttcttatccgaaatct
ttatccaaggaggccgtttccatctgcaaaggactgatgaccaaacatcccggcaagcgt
ctgggctgcgggcccgagggggaacgggacgtgcgagaacacgccttcttccggaggatc
gactgggagaaactggagaacagggagatccagccgccgttcaagcccaaagtggtgagc
caagggcgcagcccgtttcctgagccccagtccccccaatcctggaggtgtcccacccac
cctccttcttggagagaggaggccagtgacccccggcctccacagggcaagcgcctgccc
ttgccgtcggttctgtggtccgagcaagggcagaccaggccgcgaggcgggtgcgggtct
tctgtcctcacagagctgtccaatagcgtggctgcagagagccccccaccagcccgatta
aacagcaagggaggtctgcttggggtttggattttgtggactcggaattcctggctctga

DBGET integrated database retrieval system