KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510319
Entry
107510319         CDS       T06036                                 

Gene name
PREX1
Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein isoform X1
  KO
K12365  phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchanger 1 protein
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04062  Chemokine signaling pathway
ray05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107510319 (PREX1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    107510319 (PREX1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ray04990]
    107510319 (PREX1)
Domain-containing proteins not elsewhere classified [BR:ray04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   107510319 (PREX1)
SSDB
Motif
Pfam: RhoGEF DEP PDZ_6 PDZ PH PH_10
Other DBs
NCBI-GeneID: 107510319
NCBI-ProteinID: XP_015999194
LinkDB
Position
Unknown
AA seq 1660 aa
MEVPGGSDPRDGAGEGAPPDPRAPGAAAPSSGPCAAARDSERQLRLRLCVLNEILGTERD
YVGTLRFLQSAFLHRIRQNVADSVEKGLTEENIKILFSNIEDILEVHKDFLAALEYCLHP
EPQSQHELGNVFLKFKDKFCVYEEYCSNHEKALRLLVELNKIPTVRAFLLSCMLLGGRKT
TDIPLEGYLLSPIQRICKYPLLLKELAKRTPGKHPDHPAVQSALQAMKTVCSNINETKRQ
MEKLEALEQLQSHIEGWEGSNLTDICTQLLLQGTLLKISAGNIQERAFFLFDSLLVYCKR
KSRVTGGKKSTKRTKSINGSLYIFRGRINTEVMEVENVEDGTADYHSHGYTVTNGWKIHN
TAKNKWFVCMAKTAEEKQKWLDAIIREREQRESLKLGMERDAYVMIAEKGEKLYHMMMNK
KVNLIKDRRRKLSTVPKCFLGNEFVAWLLEIGEISKTEEGVNLGQALLENGIIHHVSDKH
QFKNEQVMYRFRYDDGTYKARSELEDIMSKGVRLYCRLHSLYTPVIKDRDYHLKTYKSVL
PASKLVDWLLAQGDCQTREEAVALGVGLCNNSFMHHVLEKSEFKDESQYFRFHADEEMEG
ISSKNKQLRNDFRLVENILGKRLLILPQEEDYGFDMEEKNKAVVVKSVQRGSLAELAGLQ
AGRRIYAVNEDLVFLRPFGEVESILNQSFCSRRPLRLLVATKAKEIVKVPDHPEALCFQI
RGAAPPYVYAVGRGSEAAAAGLCAGQCILKVNGNNVMNDGAPEVLEHFQAFRNHREEALG
LYQWVYHTHEDAQEARASQEAPGEDPGGEGTREEDQPDSGNGTAFPLMSLGPQLSLHEDS
PVVSLTVDNVHLEHGVVYEYVSTAGVKCHVLEKIVEPRGCFGLTAKILEAFAADDGVFVQ
NCGRLMALNNNIKTMSHYEFRNICDTKLERISQRIVCYQEFAAQLKSRVSPPFKQAPLEL
HPLCGLDFCPTNCHINLMEVSYPKTTPSVGRSFSIRFGRKPSLIGLDPEQGHLNPMSYTQ
HCITTMAAPSWKCLPAVDGDLQCHGLHDSSFGSANGALGLEDRGLSFLLKQEDREIQDAY
LQLFTKLDVALKEMKQYVTQINRLLSTITEPTSGGSCDPPLAEEASSSPLVSEESEMDRT
DHGGIKKVCFKVSEEDQEDSGHDTMSYRDSYSECNSNRDSVLSCTSMRSNSSYLGSDEMG
SGDELPCDMRIPSDKQDKLHGCLEHLFNQVDSIHTLLKGPVMSRAFEETRHFPMDHSLQE
FKQKEECTMRGRSLIQISIQEDPWNLPNSIKTLVDNIQRYVEDGKNQLLLALLKCTDTEL
QLRRDAIFCQALVAAVCTFSEQLLAALSYRYNNNGEYDESSRDASRKWLEQVAATGVLLH
CQSLLSPATVKEERIMLEDIWVTLSELDNVTFSFKQLDENYVANTNVFYHIEGSRQALKV
VFYLDSYHFSKLPSRLESGASLRLHTVLFTKSLENAEGPPPPGGQAAEDLQQEINAQSLE
KVQQYYRKLRAFYLERSNLPTDASTTAVKIDQLIRPINALDELCRLMKSSVHPKPGAAGS
LGAGLIPISSELCYRLGACQIAMCGTGMQRSTLSVSLEQAAILARSHGLLPKCIMQATDI
MRKQGPRVEILAKNLRVKDQMPQGAPRLYRLCQPPVDGDL
NT seq 4983 nt   +upstreamnt  +downstreamnt
atggaggtacccggcggcagcgatcccagagacggggctggggaaggtgcccccccggac
cctcgggcccccggcgccgccgcccccagctccggcccgtgcgcggccgctcgggattcg
gagcgccagctgcgccttcgcctctgcgtcctcaacgagattctgggcaccgagagggac
tacgtgggcaccttgcgctttttgcagtcggcgttcctgcatcgcatccggcagaatgtg
gctgactccgtggagaagggcctcacggaggagaacatcaagatcctgttctcgaacatc
gaagacatcctggaagttcacaaggatttcttggccgccttggagtattgtttacatcca
gagccacaatctcagcatgaacttggcaacgttttcttaaaattcaaggacaagttctgc
gtgtacgaggaatactgcagcaaccacgagaaggccctgcggctgcttgtggaactgaac
aaaatccccactgtgcgcgccttccttttgagctgcatgcttctgggaggccggaagacc
acggacattcctctggagggctacctgctgtccccaattcagaggatctgcaaataccca
ctcctcctcaaggagctggccaagaggacccctggcaaacacccggaccaccccgcggtc
cagagcgccctgcaggccatgaagaccgtctgctccaacatcaatgagacgaagcggcag
atggagaagctggaggccctggagcagttacagtcccacatcgaaggctgggagggctcc
aacctcacggacatctgcacccagctcctcttgcaagggactttgttaaaaatctctgca
ggcaacatccaggagagggccttcttcctcttcgacagcctccttgtctattgcaagcgg
aaatccagggtcaccggggggaagaaatccaccaagaggaccaaatccatcaatggctcc
ctctacatcttcaggggtcggatcaacacggaagtcatggaggtggagaacgtggaagat
gggacagcggattaccacagccatggctacaccgtcaccaatggctggaagatccacaac
acagccaagaacaagtggtttgtctgcatggccaagacggcggaggagaagcagaagtgg
ctggatgccatcatccgcgagcgggaacagcgcgagagcctgaagctgggcatggagcgg
gatgcctacgtcatgatcgcagagaagggggagaagctttaccacatgatgatgaacaag
aaggtgaacttgatcaaggaccgccggagaaagctcagcaccgtccccaagtgcttcctt
ggcaatgagtttgttgcgtggctcttggaaattggtgaaatcagcaagactgaagaaggc
gtcaacttgggccaagccttgttggagaatggtattatccaccatgtctctgacaagcac
cagttcaagaacgagcaggtgatgtaccgcttccgctacgacgatggcacctacaaggcc
cgcagtgagctggaggacatcatgtccaagggcgtgaggctttactgccgtcttcacagc
ctctacacccctgtgatcaaagaccgcgattaccacctgaagacctacaagtcggtgctg
cctgcgagcaagctggtggactggctgctggctcagggagattgccagacgcgggaggag
gcggtggcgcttggcgtgggtttgtgtaacaacagcttcatgcaccatgtgctggagaag
agcgagttcaaggatgagtcccagtacttccgcttccacgcagacgaggagatggaggga
attagcagcaagaacaaacagcttcgcaacgacttcaggctggtggagaacattctgggc
aagcgcctgctgatcctgccccaggaggaagactacggcttcgacatggaggagaagaac
aaggccgtggtggtgaaatcggtgcagaggggctcgctggcggagctggccggcctgcag
gcggggaggaggatctacgccgtcaacgaggacctggtgttcctgcgccctttcggcgag
gtggagtccatcctcaaccagtccttctgctcccgccgccccctgcgcctcctggtggcc
accaaggccaaagagattgtcaaagtccccgaccatccagaggctctgtgcttccagatc
cgcggagccgccccgccgtatgtctacgctgtggggagaggctcagaggctgcggccgca
gggctctgtgctggccagtgtatcttgaaggtcaacggcaacaacgtgatgaatgacggg
gcccctgaagtcctggagcacttccaggcattccggaaccaccgagaagaggccctgggc
ctgtaccagtgggtctaccacacccacgaggatgcccaggaggcccgcgccagccaggag
gcacccggcgaggaccccggtggtgagggcactcgggaggaagaccagcctgactcaggt
aatgggacagccttccccctgatgtccctgggtcctcagctgagcctgcatgaggacagc
cctgtggtcagcctaacggtggacaacgtgcacctggaacatggcgtggtgtatgagtac
gtgagcacggcaggtgtcaagtgtcacgtgctggagaagatcgtggagccccgcggctgc
ttcggcctcacagccaagatcctcgaggcctttgctgccgatgacggtgtcttcgtgcag
aactgtgggcggctcatggcgctgaacaacaacatcaagaccatgtcccattacgagttt
cgtaatatctgcgacactaagctggagcgcatcagccagaggattgtctgctaccaggag
tttgcagcccagttgaagagcagagtcagcccacccttcaaacaagcacccctggaactc
catccactgtgtggcctggacttctgccccaccaactgccacatcaacctcatggaagtg
tcctaccccaagaccactccctcggttggcaggtccttcagtattcgcttcggtcgtaaa
ccctccctcatcggccttgacccagagcaaggccacctgaaccccatgtcctacacccag
cactgcatcaccaccatggcggccccgtcctggaagtgcctgcctgctgtggatggggac
ctccaatgccacggtctccatgacagcagctttgggtcagccaatggggctctgggactg
gaggaccggggcctgagcttcctcctcaagcaggaggaccgtgagatccaggatgcctac
ctgcagctctttaccaaactggacgtggccctgaaggagatgaagcagtatgtcactcag
atcaacaggctgctgtccaccatcacggagcccacctcgggcgggtcctgcgatccgccc
ttggccgaggaggcctcgtcctccccactggtcagtgaagagagcgagatggacaggacc
gaccatgggggcatcaagaaagtgtgcttcaaggtgtctgaggaggaccaggaagactca
ggtcatgacaccatgagctaccgcgactcctacagtgagtgtaacagcaatcgggactcc
gtcctgtcctgcaccagcatgagaagtaacagctcctacctgggcagtgacgagatgggg
tctggagacgagctgccctgcgacatgcggatcccatcagacaagcaggacaagctccac
ggttgcctggaacatctctttaaccaggtggactccatccacacactcctcaaggggccg
gtcatgagcagggctttcgaagagactaggcatttccctatggaccacagcttgcaagag
ttcaaacagaaagaagagtgtacgatgcgtggccggagcttgatccagatcagcattcag
gaggacccctggaacctccccaactccatcaagaccctggtggacaacattcagagatac
gtggaagatgggaagaaccagctgcttctggctttgctgaaatgcacagataccgagctg
cagctgcgcagggacgcgatcttctgccaggccctggtggccgccgtgtgcaccttctcg
gagcagctcctggccgccctcagttaccgctacaacaacaacggcgagtacgacgagagc
agccgggacgccagccgcaagtggctggagcaggtggcggccactggcgtcctcctgcac
tgccagtccctgctctcgccggccactgtgaaggaggaacggatcatgctggaggacatc
tgggtgactctgtcggaactggacaacgtcaccttctcttttaagcagctggacgagaac
tatgtggccaacaccaacgtcttctaccacatcgagggcagccggcaggcgctgaaggtc
gtcttctacctcgacagctaccacttctcgaagctgccgtcccgcctggagagcggggcc
agcctgaggctgcacactgtgctcttcacaaaatcgctggagaatgctgaggggccgcct
ccgccgggcggccaggctgcggaagacctgcagcaggagatcaacgcccagtccctggag
aaggttcagcagtattaccgcaaactcagggcgttttacctggaacggtccaacctgccc
acggatgccagcaccacggcagtgaagatagaccagctgatccgccccatcaatgccctg
gatgagctctgccgcctcatgaagtcctccgtgcaccccaagcctggtgctgctgggagc
ttgggtgctggcctcatccccatctcctccgagctctgctaccgcctgggggcttgccag
atcgccatgtgtggcacgggcatgcagaggagcaccctgagcgtctccctggaacaggca
gccatcctggctcgaagccacgggctgctgcccaagtgcatcatgcaggccacggacatc
atgcggaagcagggccccagggtggagattctggccaaaaatctgcgggtcaaggatcag
atgccccagggtgcaccgcggctctaccgcctgtgccagccgccggtggatggagacctc
tga

DBGET integrated database retrieval system