KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510528
Entry
107510528         CDS       T06036                                 

Gene name
CALD1
Definition
(RefSeq) LOW QUALITY PROTEIN: caldesmon
  KO
K12327  caldesmon
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107510528 (CALD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107510528 (CALD1)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     107510528 (CALD1)
SSDB
Motif
Pfam: Caldesmon
Other DBs
NCBI-GeneID: 107510528
NCBI-ProteinID: XP_015999633
LinkDB
Position
Unknown
AA seq 748 aa
MDDFERRRELRRQKREEMRLEAERIAYQRNDDDEEEAARERRRRARQERLRQKQEEESFG
QVTDQVEVNAQNSVPDEVKTTTANAQVEGDDEAAFLERLARREERRQKRLQEALERQKEF
DPTITDASLSLPSRRTQNDTEENENAEKEEISESRQERYEIEETEIVTKSYQKDDWRVAD
ENKKEEKEKEGEEEEKPKPGSIKENQVEAMVEEKTAEPQEEAMGMTLKNGQISADGPHTE
EREPGSDEVISEEKMEAERERAEAERVRLEAEERERIKAEQDRKIAEEKARLEAEEKERE
RERLERERREAEERERVKEEERXRAAEERRAKAEEEAKAQMEEQTRKKQLEEKSEVPEKK
IKGEEIEEKIEGKWVSGKKGLEDKRQTAVQKQQEEEKGAKVQPKREKSQEDKPTFKKEEI
KDERMKKDKEPREEVKSFLDGKKGFTEVKSQNGEFMTHKLKHTENTFSRPGGRASEAKEA
EGASQVEAGKRLEELRRRRGETESEEFEKLKQKQQEAALELEELKKKREERRKVLEEEEQ
RRKQEEADRKVREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLADDKKPFKCFTPKGSSL
KIEERAEFLNKSVQKSGVKSTHQAAVVSKIDSRLEQYTSAIEGTKTAKLTKPAASDLPVP
AEGVRNMKSMWEKGNVFSSPAASGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPS
DLRPGDVSGKRNLWEKQSVDKVTSPTKV
NT seq 2247 nt   +upstreamnt  +downstreamnt
atggatgactttgaacgtcgcagagaacttaggaggcaaaaacgggaagagatgcgcttg
gaagcagaaagaatcgcctaccagaggaacgacgacgatgaggaagaggccgcccgggaa
cggcgccgccgagcccgacaggaaaggctacggcagaaacaagaggaagaatcttttggg
caggtgactgaccaggtggaggttaacgcccagaacagtgtgcctgacgaggtcaagacg
accaccgcgaacgctcaggtggagggcgacgacgaggccgcgttcctggagcgcctggcc
cggcgggaggagagacgccaaaaacgcctccaggaggctctggagcggcagaaggagttc
gaccccacaataacagacgcaagcttgtcgctaccgagcagaagaacgcagaacgacacg
gaagaaaacgaaaatgcagagaaggaagaaataagcgaaagtcgccaagaaagatacgag
atagaggaaacggaaatcgtcacgaagtcctaccagaaggatgactggagggttgccgac
gagaacaagaaagaagaaaaagaaaaggagggagaggaagaagagaagccaaagccaggg
agcatcaaagaaaatcaggtagaggcgatggtagaagaaaaaacagcagaaccccaagag
gaagccatgggaatgacactgaaaaatgggcagatcagtgcagacgggcctcacacggag
gagagggaaccaggctcagatgaggttatcagtgaggaaaagatggaggcagaaagggaa
agggcggaggcagagagggtcaggttggaagcagaagagagagaaagaattaaagctgag
caagaccgaaagatagcagaggagaaagcaagactcgaagctgaagaaaaagagagagag
agagagagactagagagagaaagaagggaggcagaagagagggaaagagtgaaggaggaa
gagaggnngagagcagcagaggagagacgggcaaaggccgaggaggaagcgaaagctcag
atggaagagcaaacacgtaaaaagcagctagaagagaaaagtgaggtgcccgagaaaaaa
ataaaaggggaagagatagaagaaaaaatagaagggaagtgggtcagtggaaagaaagga
ctcgaagataaacgtcagacagctgtccaaaaacaacaggaagaagaaaagggggctaaa
gtgcaacctaagagagagaaatcccaagaagacaagcctacgttcaaaaaagaagagatc
aaagatgagaggatgaaaaaggacaaagagcccagagaagaagttaagagcttcttggat
ggaaagaagggattcacagaagtcaagtcgcagaatggagaattcatgacccacaaactt
aaacacactgagaatactttcagccgccccggagggagggctagcgaggccaaggaggcg
gaaggcgcgtcccaagtggaagcgggcaagcgcctggaggagctgaggcgccgccgtggg
gaaaccgagagcgaagagttcgagaagctcaaacagaagcagcaggaggcagccctggag
ctcgaggagctgaagaaaaagagggaggagcgaaggaaggttctggaggaggaggagcag
aggaggaagcaggaggaggccgaccgaaaagtcagagaggaggaagagaagaggaggcta
aaggaagagattgaaaggcgaagggcagaagctgctgagaaacgccagaagatgccagag
gatgggttagcagatgacaagaagccattcaagtgtttcactcctaaaggctcatctctc
aagatagaagagcgagcagaatttttgaacaagtctgtgcagaaaagtggtgtcaaatca
actcatcaggcagcagttgtctccaagattgacagcagactggagcaatacaccagtgcc
atcgagggaacgaaaactgcgaaacttacaaagccagcagcctcggatcttccagttcct
gccgaaggcgttcgcaacatgaagagcatgtgggagaaaggcaatgtgttctcatcccct
gctgcgtcgggcacgccaaacaaggaaactgccggcctgaaggtgggggtttccagccgc
atcaatgaatggctaactaaaaccccggatggaaacaagtcacctgctcccaaaccttct
gatttgaggccaggagacgtatctggcaagcggaacctctgggaaaagcaatctgtggat
aaggtcacatcccccactaaggtctga

DBGET integrated database retrieval system