KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510637
Entry
107510637         CDS       T06036                                 

Gene name
BMPR1B
Definition
(RefSeq) bone morphogenetic protein receptor type-1B isoform X1
  KO
K13578  bone morphogenetic protein receptor type-1B [EC:2.7.11.30]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04350  TGF-beta signaling pathway
ray04360  Axon guidance
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107510637 (BMPR1B)
   04390 Hippo signaling pathway
    107510637 (BMPR1B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107510637 (BMPR1B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107510637 (BMPR1B)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    107510637 (BMPR1B)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107510637 (BMPR1B)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     107510637 (BMPR1B)
Protein kinases [BR:ray01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   107510637 (BMPR1B)
CD molecules [BR:ray04090]
 Proteins
  107510637 (BMPR1B)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TGF_beta_GS Activin_recp FTA2
Other DBs
NCBI-GeneID: 107510637
NCBI-ProteinID: XP_015999826
LinkDB
Position
Unknown
AA seq 525 aa
MNHQEHCVLQNSAVYLSAKFLDNMLLRSSGKLNVGTKKEDGESTAPTPRPKILRCKCHHH
CPEDSVNNICSTDGYCFTMIEEDDSGMPVVTSGCLGLEGSDFQCRDTPIPHQRRSIECCT
ERNECNKDLHPTLPPLKNRDFVDGSIHHKALLISVTVCSLLLVLIILFCYFRYKRQETRP
RYSIGLEQDETYIPPGESLRDLIEQSQSSGSGSGLPLLVQRTIAKQIQMVKQIGKGRYGE
VWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYL
ITDYHENGSLYDYLKSTTLDTKSMLKLAYSSVSGLCHLHTEIFSTQGKPAIAHRDLKSKN
ILVKKNGTCCIADLGLAVKFISDTNEVDIPPNTRVGTKRYMPPEVLDESLNRNHFQSYIM
ADMYSFGLILWEVARRCVSGGIVEEYQLPYHDLVPSDPSYEDMREIVCIKKLRPSFPNRW
SSDECLRQMGKLMTECWAHNPASRLTALRVKKTLAKMSESQDIKL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaatcatcaagagcattgtgtgctacaaaactcagcagtatatttatctgcaaaattc
ctcgataacatgcttttgcgaagttcaggaaaattaaatgtgggcaccaagaaagaggat
ggtgagagtacagcccccacacctcgtccaaagatcttgcgttgtaaatgccaccatcat
tgtccagaagattcggtcaacaatatttgcagcacagatggatattgtttcacaatgata
gaagaagatgattctgggatgcctgtggtaacttctggatgtctaggactagaaggctca
gattttcagtgtcgggacactcccatccctcatcaaagaagatcaatcgaatgctgcaca
gaacggaatgaatgtaataaagatctgcaccccaccctgcctccactgaaaaacagagat
ttcgttgatggatctatacaccacaaagccttacttatatctgtgactgtctgtagtttg
ctcttggtccttatcattttattctgttatttcaggtataaaagacaagaaaccagacct
cggtacagcattggattagaacaggatgaaacttatattcctcctggagaatccctgaga
gacttaattgagcagtctcaaagctcaggaagtggatcaggcctccctctgctggtccaa
aggactatagctaagcagattcagatggtgaaacagattggaaaaggtcgctatggggaa
gtttggatgggaaagtggcgtggcgaaaaggtagctgtgaaagtgttcttcaccacagag
gaagccagctggttccgagaaacagaaatatatcagacagtgttgatgaggcatgaaaac
attttggggttcattgcagcagatatcaaagggacagggtcctggacacagttgtaccta
atcacagactatcatgaaaatggttccctctatgattatctgaagtccaccaccttagat
actaaatcaatgctgaagttagcctattcttctgtcagtggcttatgtcatttacacact
gaaatttttagtactcaaggcaaaccggcaattgcccatcgagatctgaaaagtaagaac
atcctggtgaagaaaaatggaacttgctgtatagctgacctgggcctggctgttaaattt
attagcgatacaaatgaagttgacataccacccaacactcgagttggcaccaaacgctat
atgcctccagaagtgttggacgagagcttgaatagaaatcactttcagtcttacatcatg
gccgacatgtacagttttggactcatcctttgggaggttgctaggagatgtgtatcagga
ggtatagtggaagaataccagcttccctatcatgatctagtgcccagtgatccatcttac
gaggacatgagagagatcgtgtgcatcaagaagctacgtccctcgttcccaaaccgatgg
agtagtgatgagtgtctaaggcagatggggaaactcatgacggaatgctgggctcacaat
cctgcgtccagactgacagccctgcgtgttaagaaaacacttgccaaaatgtcagagtcc
caggacattaaactctga

DBGET integrated database retrieval system