KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510686
Entry
107510686         CDS       T06036                                 

Gene name
GABRD
Definition
(RefSeq) LOW QUALITY PROTEIN: gamma-aminobutyric acid receptor subunit delta
  KO
K05184  gamma-aminobutyric acid receptor subunit delta
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04723  Retrograde endocannabinoid signaling
ray04727  GABAergic synapse
ray05032  Morphine addiction
ray05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107510686 (GABRD)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107510686 (GABRD)
   04723 Retrograde endocannabinoid signaling
    107510686 (GABRD)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107510686 (GABRD)
   05033 Nicotine addiction
    107510686 (GABRD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107510686 (GABRD)
Ion channels [BR:ray04040]
 Ligand-gated channels
  GABA-A
   107510686 (GABRD)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107510686
NCBI-ProteinID: XP_015999914
LinkDB
Position
Unknown
AA seq 452 aa
MDALAWLLPPLLLLCAQQHGGTRAMNDIGDYVGSNLEISWLPNLDGLMEGYARNFRPGIG
GPPVNVALAIEVASIDHISEANMEYTMTVFLHQSWRDSRLSYNHTNETLGLDSRFVDKLW
LPDTFIVNAKSAWFHDVTVENKLIRLQPDGVILYSIRITSTVACDMDLAKYPMDEQECML
HLESYGYSSEDIVYYWSENQEHIHGLDKLQLAQFTITSYRFTTELMNFKSAGQFPRLSLH
FHLRRNRGVYIIQSYMPSILLVAMSWVSFWISQAAVPARVSLGITTVLTMTTLMVSARSS
LPRASAIKALDVYFWICYVFVFAALVEYAFAHFNADYRRKQKAKVKVPEQRAEMDVKDAI
VLLSLSAAGVSRELAASRRPCRVPGHLVGSCSRSGVEAGETQEQGAARAGGGGGLRALFK
PIAADTVDVYARALFPAAFAAVNVIYWAAYAM
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggacgcgctggcctggctgctgcccccgctcctcctgctctgcgcgcagcagcacggc
ggcaccagagcgatgaatgacattggggactatgtcggctccaacctggagatatcctgg
ctccccaacctcgacggcctgatggagggctacgcccggaacttccggccgggcatcgga
ggcccccccgtgaacgtggcgctggccatcgaggtggccagcatcgaccacatctctgaa
gcgaacatggagtataccatgacggtgttcctgcaccagagctggcgcgacagccggctg
tcctacaaccacaccaacgagaccctgggcctggacagccgcttcgtggacaagctgtgg
ctgccggacaccttcatcgtgaatgccaagtccgcctggttccacgacgtgaccgtggag
aacaagctcatccggctgcagcccgacggggtgatcctgtacagcatccgcatcacctcc
acggtggcctgcgacatggacctggccaagtaccccatggacgagcaggagtgcatgctg
cacttggagagctacggctactcgtccgaggacatcgtctactactggtctgagaaccag
gagcacatccacgggctggacaagctgcagctggcgcagttcaccatcactagctaccgc
ttcaccacggagctgatgaacttcaaatcggccggccagttcccccggctcagcctgcac
ttccacctccggaggaaccggggcgtctacatcatccagtcctacatgccgtccatcctg
ctggtcgccatgtcctgggtctccttctggatcagccaggcggcggtgcccgccagggtg
tctctaggcattaccacggtgctgaccatgaccacgctgatggtgagcgctcgctcctcc
ctcccgcgggcctcggccatcaaagcgctggacgtgtacttctggatctgctacgtgttc
gtgttcgctgcgctggtggagtacgccttcgcccacttcaacgccgactaccggaggaag
caaaaggccaaggtcaaggtcccggagcagagggcagagatggacgtgaaggacgccatc
gtgctgctctcgctgtcggccgccggtgtctcccgggagctggctgcgtcccgccggccg
tgccgcgtgcccggccacctcgtgggctcctgcagtcggtcgggagtggaggccggggag
acgcaggagcagggggcggcccgcgcggggggcgggggcggcctccgcgcgctcttcaag
cccatcgccgcggacaccgtcgacgtgtacgcccgcgccctgttccccgcggccttcgcg
gccgtcaacgtcatctactgggcagcctacgccatgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511463
Entry
107511463         CDS       T06036                                 

Gene name
GABRG1
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit gamma-1 isoform X1
  KO
K05186  gamma-aminobutyric acid receptor subunit gamma
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04723  Retrograde endocannabinoid signaling
ray04727  GABAergic synapse
ray05032  Morphine addiction
ray05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107511463 (GABRG1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107511463 (GABRG1)
   04723 Retrograde endocannabinoid signaling
    107511463 (GABRG1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107511463 (GABRG1)
   05033 Nicotine addiction
    107511463 (GABRG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107511463 (GABRG1)
Ion channels [BR:ray04040]
 Ligand-gated channels
  GABA-A
   107511463 (GABRG1)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107511463
NCBI-ProteinID: XP_016001317
LinkDB
Position
Unknown
AA seq 465 aa
MGSWKAFLFSPFLLWSQSRGMRLMFLLLALHLGNCVDKADDEDDEDLTVNKTWVLAPKIH
EGDITQILNSLLQGYDNKLRPDIGVRPTVIETDIYVNSIGPVDPINMEYTIDIIFAQTWF
DSRLKFNSTMKVLMLNSNMVGKIWIPDTFFRNSRKSDAHWITTPNRLLRIWNDGRVLYTL
RLTINAECYLQLHNFPMDEHSCPLEFSSYGYPKNEIEYKWKKPSVEVADPKYWRLYQFAF
VGLRNSTEISHTISGDYIIMTIFFDLSRRMGYFTIQTYIPCILTVVLSWVSFWINKDAVP
ARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFAALMEYGTLHYFTSN
KQGKTTRDRKLKNKASMSTGLHSGSTLIPMNNISLPQGEDDYGYQCLEGKDCASFFCCFE
DCRTGSWREGRIHIRIAKIDSYSRIFFPTAFALFNLVYWVGYLYL
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgggttcttggaaagcttttctcttctctccttttcttctgtggagtcaaagtagaggg
atgaggctgatgttcttgttactggccctgcatttgggaaactgtgttgataaagcagat
gatgaagatgatgaggatttaacagtgaacaagacttgggtcttggcaccaaagattcat
gaaggagatataacacaaattctcaattcattgcttcaaggctatgacaataaacttcgc
ccagatataggagtgaggccaacagtaattgaaactgacatttatgtaaacagcattgga
ccagttgatcccataaatatggaatacacaattgatataatttttgcccaaacctggttt
gatagtcgtttaaaattcaatagtacaatgaaagtacttatgcttaacagtaatatggtt
ggaaaaatttggattcctgatactttcttcagaaactcaagaaaatctgatgctcattgg
ataacaacccctaatcgtctgcttcgaatatggaatgatggaagagttctatatactcta
cgattgacaattaatgcagaatgttatcttcagcttcataactttccaatggatgaacat
tcctgtccactggaattttcaagctatggatatcctaaaaatgaaattgagtataagtgg
aaaaagccttctgtagaagtagctgatcctaaatattggagattatatcagtttgcattt
gtagggttacggaattcaactgaaatttctcacacaatctctggagattatattattatg
acaatattttttgacctgagcagacgaatgggatatttcactattcagacctatattcca
tgtattctgacagttgttctttcttgggtgtctttttggatcaataaagatgcggtacct
gcaagaacctcactgggtatcactacagttctgactatgacaactctgagtacaatagcc
aggaagtcattacctaaggtttcttatgtgactgcgatggatctctttgtttctgtttgc
ttcatttttgtttttgcagccctgatggaatatggcacattgcattattttaccagcaac
aaacaaggaaagactactagagacagaaagctaaaaaacaaagcttcgatgtccactgga
ctccattctggatccactctaattccaatgaataatatttctctgccgcaaggagaagat
gattatggttatcagtgtttggagggcaaagattgtgccagcttcttctgctgctttgaa
gattgcagaacaggatcatggagggaaggaaggatacacatccgcattgccaaaatcgat
tcctattcccgaatatttttcccaacagcgtttgccctcttcaatctggtttattgggtt
ggctatctttatttgtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511477
Entry
107511477         CDS       T06036                                 

Gene name
GABRA2
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit alpha-2 isoform X1
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04723  Retrograde endocannabinoid signaling
ray04727  GABAergic synapse
ray04742  Taste transduction
ray05032  Morphine addiction
ray05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107511477 (GABRA2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107511477 (GABRA2)
   04723 Retrograde endocannabinoid signaling
    107511477 (GABRA2)
  09157 Sensory system
   04742 Taste transduction
    107511477 (GABRA2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107511477 (GABRA2)
   05033 Nicotine addiction
    107511477 (GABRA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107511477 (GABRA2)
Ion channels [BR:ray04040]
 Ligand-gated channels
  GABA-A
   107511477 (GABRA2)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb DUF5522
Other DBs
NCBI-GeneID: 107511477
NCBI-ProteinID: XP_016001333
LinkDB
Position
Unknown
AA seq 506 aa
MKTKLNIFNMQLLLLVFLMWDPVRLVLANIQEDEAKNNITIFTRILDRLLDGYDNRLRPG
LGDSITEVFTNIYVTSFGPVSDTDMEYTIDVFFRQKWKDERLKFKGPMNILRLNNLMASK
IWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLYTMRLTVQAECPMPMDAHSCPLKFG
SYAYTTSEVTYIWTYNASDSVQVAPDGSRLNQYDLLGQSIGKETIKSSTGEYTVMTAHFH
LKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLP
KVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKSVVNDKSPSIKAEGITLT
YNSVKAILQGAKLIWSKCVAFSWPNLIQEKTLEYLEKWMDCITFKQSSKKEKASVMIQNN
AYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKPENKPAEAKKTFNSVSKIDRMSRIVF
PVLFGTFNLVYWATYLNREPVLGVSP
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgaagacgaaattgaacattttcaacatgcagttgctgcttcttgttttcttgatgtgg
gacccagtcaggttggtgctggctaacatccaagaagatgaagctaaaaataacattacc
atcttcacaagaattctagacagacttctggatggttacgataatcgtcttagaccagga
ctgggagacagtattactgaagtcttcactaacatctacgtgaccagttttggccctgtc
tcagacacggatatggaatatacaatagatgttttctttcgacaaaaatggaaagatgaa
cggttaaaatttaaaggtcctatgaacatccttcgacttaacaatttaatggctagcaaa
atttggactccagacaccttttttcacaatgggaagaaatcggtagctcataatatgaca
atgccaaataagcttcttcgaatccaggatgatggcactctactgtacacaatgaggctt
acagttcaagctgaatgtccaatgccaatggatgctcattcatgccctctgaaatttggc
agctatgcatatacaacctcagaggtcacttatatttggacttataatgcatctgattca
gtacaagttgctcctgatggctccaggttaaatcaatatgatttgttgggccaatcaatt
gggaaggagacaattaaatccagtacaggtgaatatactgtaatgacagctcatttccac
ttgaaaagaaaaattgggtattttgtgattcagacatatctgccttgcatcatgactgtc
attctctcccaagtgtcattctggcttaacagagaatctgtgcctgcaagaactgtattt
ggcgtaacaactgttttaacaatgacaactctaagcatcagtgcccggaattctctcccc
aaagtggcttatgcaactgctatggactggtttattgctgtttgttatgcatttgtgttc
tctgccctaattgaatttgcaactgttaattacttcaccaaaagaggatgggcttgggat
gggaagagtgtagtaaatgacaagtccccttcaataaaagctgaaggcattacattaaca
tacaactcagtgaaggcaattcttcaaggagctaagctaatatggtccaagtgtgtagct
ttctcatggcccaatttaatccaagaaaagactttagagtacttagagaagtggatggac
tgtataaccttcaaacaatcttctaaaaaagagaaagcctctgtaatgatacagaacaat
gcctatgcagtggctgttgccaattatgccccgaacctttcaaaagacccagttctctcc
accatctccaagagtgcaaccacgccagaacccaacaagaagccggaaaacaagccagct
gaagccaaaaaaaccttcaacagtgttagcaaaattgacagaatgtctagaatagttttc
ccagttttgtttggtacatttaatttagtttactgggctacatatttaaacagagaacct
gtattaggggtcagtccttga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515749
Entry
107515749         CDS       T06036                                 

Gene name
GABRG3
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit gamma-3 isoform X1
  KO
K05186  gamma-aminobutyric acid receptor subunit gamma
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04723  Retrograde endocannabinoid signaling
ray04727  GABAergic synapse
ray05032  Morphine addiction
ray05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107515749 (GABRG3)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107515749 (GABRG3)
   04723 Retrograde endocannabinoid signaling
    107515749 (GABRG3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107515749 (GABRG3)
   05033 Nicotine addiction
    107515749 (GABRG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107515749 (GABRG3)
Ion channels [BR:ray04040]
 Ligand-gated channels
  GABA-A
   107515749 (GABRG3)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107515749
NCBI-ProteinID: XP_016010346
LinkDB
Position
Unknown
AA seq 517 aa
MSCPRLRGQPGAHVPLRASIRVARGSGPVPPTSHSAPRRTGRGVLSARGGFAGPPEAAAQ
FPPPSLPVTVRKGQREAPSAKGSCAPRLLCHVVPLTCTASGSRRGPLARQVSASNVGRRC
SRRACRGRDRWIERPPHVVEKEYQIDVFFAQTWTDSRLRFNSTMKLLTLNSNMVGLIWVP
DTIFRNSKTAEAHWVTTPNQLLRIWGDGKILYTLRLTINAECQLQLHNFPMDEHSCPLTF
SSYGYPREEMVYRWRKSSVEAADQKSWRLYQFDFMGLRNTTEIVTTSAGDYVVMTIYFEL
SRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTALGITTVLTMTTLSTIARTSLPR
VSYVTAMDLFVTVCFLFVFAALMEYAALNYYSSCRRPTAAKKQLKPLQPDPSQWLHGRMA
LPAPSNYSLLDVRPPPTVVTLGHAVYWPELEDACAAGCLDGKDCRSFFCCYEECRAGAWR
RGRAHVHVLELDAYARVLFPTSFLLFNLVYWVGYLYL
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgtcctgccctcggctccgggggcagccgggggcccacgttcccctccgggcctccatc
cgcgtggcccgtggttctggcccggttcctccgactagccactcggcccctcgtcggaca
ggacggggcgttctgagcgcgaggggcggtttcgcggggccgccggaggccgctgcgcag
ttccctcccccctccttgccagtgaccgtcaggaagggacagagggaggccccctctgcc
aagggctcctgtgcgccccggcttctctgtcacgtcgtcccgttaacctgcacggccagc
gggagccgacgtgggccgcttgcgcgacaggtttcagcgtcaaatgtcggccgacggtgc
tcgagaagggcctgccgggggcgcgaccgctggatcgaacgccctcctcacgtcgtcgaa
aaggagtaccagatcgacgtgttttttgcccagacctggacggacagccgcctgcggttc
aacagcacgatgaagctgctcacgctcaacagcaacatggtgggcttgatctgggtgccg
gacaccatcttccgcaactccaagaccgcggaggcgcactgggtcaccacccccaaccag
ctcctcaggatctggggcgacggcaagatcctctacaccctacggctcaccatcaacgcc
gagtgccagctgcagctgcacaacttccccatggacgagcactcctgcccgctgaccttc
tccagctatggctaccccagggaagagatggtttacagatggaggaaaagctcggtggag
gcggcggaccagaagtcctggcggctctaccagtttgacttcatgggcctccgaaacacc
accgaaatcgtgacaacgtcggcaggtgactacgtcgtcatgacgatatattttgagctg
agtcggaggatgggttacttcaccattcagacttacatcccctgcattctgaccgtggtt
ctatcctgggtgtcattttggatcaaaaaagacgccacgccagcacgaaccgcattaggc
atcaccacggtgctgactatgaccacgctcagcaccatcgccaggacctccttgccccgc
gtgtcctacgtgacagccatggacctgttcgtgaccgtgtgcttcctgtttgtcttcgcc
gccctgatggagtacgccgccctcaactactactccagctgcaggaggcccacggccgcg
aagaagcagctgaagccgctgcagccggatccctctcagtggctccacgggcggatggcc
ctgccagccccctcgaactattccctgctggacgtgaggccgccgcccacggtggtcacg
ctgggccacgccgtgtactggccggagctggaggacgcctgcgcggccggctgcctggac
ggcaaggactgccgcagcttcttctgctgctacgaggagtgccgggcgggcgcctggcgc
cgcggccgcgcccacgtgcacgtcctggagctggacgcgtacgcccgcgtgctcttcccc
acgtccttcctgctcttcaacctggtctactgggtcggctacctgtacctctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515750
Entry
107515750         CDS       T06036                                 

Gene name
GABRB3
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit beta-3
  KO
K05181  gamma-aminobutyric acid receptor subunit beta
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04723  Retrograde endocannabinoid signaling
ray04726  Serotonergic synapse
ray04727  GABAergic synapse
ray05032  Morphine addiction
ray05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107515750 (GABRB3)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107515750 (GABRB3)
   04726 Serotonergic synapse
    107515750 (GABRB3)
   04723 Retrograde endocannabinoid signaling
    107515750 (GABRB3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107515750 (GABRB3)
   05033 Nicotine addiction
    107515750 (GABRB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107515750 (GABRB3)
Ion channels [BR:ray04040]
 Ligand-gated channels
  GABA-A
   107515750 (GABRB3)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb OAD_gamma
Other DBs
NCBI-GeneID: 107515750
NCBI-ProteinID: XP_016010348
LinkDB
Position
Unknown
AA seq 471 aa
MWGLAGGRLLGFFSAPVLVAVVCCAQSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPP
VCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPD
TYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIE
SYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLK
RNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKI
PYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGKGPQRQKKLAEKTAKGKNGRSKSESNR
VDAHGNILLTSLEVHNEMNEVAGAVGDARNSAISFDNSGIQYRKQAAPREGRPGGDRGLP
LKKTQLRRRSSQLKIKIPDLTDVNAIDRWSRVVFPLTFSLFNLVYWLYYVN
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgtggggcctcgcgggagggcggctgctgggcttcttctccgcgccggtgctggtggcc
gtggtctgctgcgcgcagagcgtgaacgaccccgggaacatgtcctttgtgaaggagacg
gtggacaagctgctgaaaggctacgacattcgcctgagacccgacttcggggggcccccg
gtctgcgtggggatgaacatcgacatcgccagcatagacatggtctccgaagtcaacatg
gattacaccttaaccatgtattttcaacagtattggagagacaagagactcgcctattcc
gggatcccgctcaacctcacgcttgacaatcgagtggccgaccagctctgggtgcccgac
acctatttcttaaatgacaagaagtcgtttgtgcacggagtgacggtgaaaaaccgcatg
atacggcttcaccccgatgggaccgtgctgtacgggctcaggatcaccaccaccgcggcc
tgcatgatggacctgaggcggtatccgctggacgagcagaactgcaccctggagattgaa
agctatggctacaccacggacgacatcgagttctactggcgcggcggggacaaggccgtc
accggggtggagaggatcgagctcccgcagttctccatcgtggagcaccggctggtctcg
aggaacgtcgtcttcgccacaggcgcctacccccggctgtccctgagcttccggctgaag
aggaacatcggctacttcatcctgcagacctacatgccgtccatcctcatcaccatcctc
tcctgggtgtccttctggatcaactacgacgcgtccgcggccagggtcgccctcggcatc
accaccgtcctgaccatgacgaccatcaacacgcacctgcgggagacgctgcccaaaatc
ccctacgtcaaagccatcgacatgtacctcatgggctgcttcgtgttcgtgttcctggcc
ctgctggagtacgccttcgtcaactacatcttcttcggcaaaggcccgcagcggcagaag
aagctggcggagaagacggccaagggcaagaacggccgttcgaagagcgaaagcaaccgg
gtggacgcgcacgggaacatcctgttgacgtccctggaggtgcataacgagatgaacgag
gtggcgggcgccgtcggggacgccaggaattcagcaatatccttcgacaactcaggaatc
cagtacaggaaacaggccgcgccccgggaagggcgccccgggggggacaggggcctcccg
ctcaagaagacccagctccggaggaggtcttcgcagctcaaaatcaaaatccccgacctg
actgacgtgaacgccatagacaggtggtcccgggtggtgttcccgctcaccttctcgctc
ttcaacctggtgtactggctgtactacgtgaactga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515812
Entry
107515812         CDS       T06036                                 

Gene name
GABRA5
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit alpha-5
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04723  Retrograde endocannabinoid signaling
ray04727  GABAergic synapse
ray04742  Taste transduction
ray05032  Morphine addiction
ray05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107515812 (GABRA5)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107515812 (GABRA5)
   04723 Retrograde endocannabinoid signaling
    107515812 (GABRA5)
  09157 Sensory system
   04742 Taste transduction
    107515812 (GABRA5)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107515812 (GABRA5)
   05033 Nicotine addiction
    107515812 (GABRA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107515812 (GABRA5)
Ion channels [BR:ray04040]
 Ligand-gated channels
  GABA-A
   107515812 (GABRA5)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb CytochromB561_N
Other DBs
NCBI-GeneID: 107515812
NCBI-ProteinID: XP_016010475
LinkDB
Position
Unknown
AA seq 460 aa
MDEAMPSRLIMTKNLLLFCVSVNLASHFGLTQMPAGSAKDDNITIFTRILDGLLDGYDNR
LRPGLGERTTQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDERLRFKGPMQRLPLNNL
LASKIWTPDTFFHNGKKSIAHNMTTPNKLLRLEDDGTLLYPCSLTISAECPMQLEDFPMD
AHACPLKFGSYAYPNSEVVYVWTNGTAKSVVVAEDGSRLNQYHLMGQTVGTENVSTSTGE
YTVMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTL
SISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKKASEAAKNK
KKERELTLNTPTNASITGRLPLPLNSPSEQTPGEAADTDSAPANPAEDQTPDSKKTYNSI
SKIDKMSRIVFPVLFGTFNLVYWATYLNREPEIKGAISPQ
NT seq 1383 nt   +upstreamnt  +downstreamnt
atggacgaggcgatgccctctcgcctcatcatgaccaaaaacctcctcctcttctgcgtg
tccgtgaatctggccagtcattttggcttaacgcagatgcccgccggttcggcgaaagat
gacaacatcaccatcttcaccaggattttggacgggcttctggacggctatgacaacaga
ctgcggccggggctcggggagcgcaccacgcaggtgaggaccgacatctacgtcaccagc
ttcggcccggtgtccgacacggagatggagtacacgatcgacgtgtttttccggcaaagc
tggaaggacgagcggctgcgcttcaaaggcccgatgcagcgtctgccgctcaacaacctg
ctggccagcaagatctggacgccggacacgttcttccacaacggcaagaagtccatcgcg
cacaacatgacgacgcccaacaagctgctgcggctggaggacgacggcacgctgctctac
ccttgcagcctgaccatctccgcggagtgccccatgcagctggaggacttccccatggac
gcccacgcgtgccccctgaagttcggcagctacgcgtaccccaattctgaagtcgtctac
gtgtggaccaacggcaccgccaagtcggtggtggtggcggaagacggctccaggctgaac
cagtaccacctgatggggcagacggtgggcacggagaacgtcagcaccagcacgggcgag
tacaccgtcatgaccgcccacttccacctgaagaggaagataggctacttcgtcatccag
acctacctgccctgcatcatgacggtgatcctgtcccaggtgtccttctggctgaaccga
gagtccgtcccggccaggaccgtgttcggcgtgaccacggtgctgaccatgaccacgctg
agcatcagcgcccgcaactcgctgcccaaagtggcctacgccacggccatggactggttc
atcgccgtctgctacgccttcgtgttctccgccctcatcgagttcgccaccgtcaactac
ttcaccaagaggggctgggcctgggacggcaagaaggcctcggaggccgccaagaacaag
aaaaaggagcgtgaactcacgctcaatacgcccacgaatgccagcatcaccgggaggttg
cccctccccctcaacagccccagcgagcagaccccgggcgaggcggccgacacggactcg
gccccagcgaaccccgccgaggaccagacccccgacagcaagaagacctacaacagcatc
agcaagatcgacaaaatgtcccggatcgtgttcccggtcctgttcggcaccttcaactta
gtctactgggcgacgtatctgaacagggagccggagatcaaaggggccatctctccacag
tga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518477
Entry
107518477         CDS       T06036                                 

Gene name
GABRP
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit pi
  KO
K05189  gamma-aminobutyric acid receptor subunit pi
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04723  Retrograde endocannabinoid signaling
ray04727  GABAergic synapse
ray05032  Morphine addiction
ray05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107518477 (GABRP)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107518477 (GABRP)
   04723 Retrograde endocannabinoid signaling
    107518477 (GABRP)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107518477 (GABRP)
   05033 Nicotine addiction
    107518477 (GABRP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107518477 (GABRP)
Ion channels [BR:ray04040]
 Ligand-gated channels
  GABA-A
   107518477 (GABRP)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107518477
NCBI-ProteinID: XP_016015665
LinkDB
Position
Unknown
AA seq 440 aa
MRHSLHLTFMCLSLFTGRMCVQGNRFNAEVGRSDKLSLPGFENLTVGYNKFLRPNFGGEP
VQIALTLDIASISSISESNMDYTATIYLRQRWTDRRLVFEGNESVTLDARLVEFLWVPDT
YIVESKKSFLHEVTVGNRLIRLFSNGTVLYALRITTTIACNMDLSKYPMDTQTCQLQLES
WGYDGNDVQFSWLRGNDSVRGLENLRLAQYTIQRYFTSVTRSQQETGNYTRLVLQFELRR
NVLYFILETYVPSTFLVVLSWVSFWISLDSVPARTCIGVTTVLSMTTLMIGARTSLPNTN
CFIKAIDVYLGICFSFVFGALLEYAVAHYSSLQQRAAKDRGMPQEVEEVNITNIINSSIS
SFKRKISFATIEISGDNVDYSNLSMKTSDKFKFVFRDKMGRIVDYFTIRNPSNVDRYSKL
LFPLIFMLANVFYWAYYMYF
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgaggcacagtctccacttgaccttcatgtgtctgagtctcttcacgggaaggatgtgc
gtccaggggaaccggttcaacgcggaggtcggcagaagtgacaagctctccctgcccggc
ttcgagaatctcactgtaggatacaacaagtttctcaggcccaattttggcggggaacca
gtgcagatagccctgactctggacatcgctagtatttctagcatttcagagagtaacatg
gactacacagccaccatatacctcagacagcgctggaccgaccggcggctggtgttcgaa
ggcaatgagagcgtcaccctggacgcccggctggtggagttcctctgggtgccagacact
tacatcgtggagtccaagaagtccttcctccatgaagtcactgtgggaaacaggctcatc
cgcctcttctccaatggtacagtcctgtatgctctcaggatcacaacgactattgcgtgt
aacatggacctatctaaataccccatggacacacagacatgccagttgcagctggaaagc
tggggctatgacgggaacgacgtgcagttcagctggctgagaggcaacgactccgtgcgt
gggctggagaacctgcggctcgctcagtacaccatccaacggtacttcacctcggtcacc
agatcgcagcaggagacaggaaattacacgcggctggtcttgcagttcgagctccggagg
aatgtcctgtatttcattttggaaacctacgttccttccaccttcctggtggtgttatcc
tgggtttcgttttggatctctctcgattccgttcctgcaagaacctgcatcggagtgacc
accgtgttgtccatgaccacgctgatgattggcgcccgcacttctcttcccaacaccaac
tgcttcataaaggccatcgacgtgtacctggggatctgcttcagcttcgtgtttggggcc
ctgctggaatacgcggtcgcccactacagctccttacagcagagggcagccaaagacagg
gggatgccacaggaagtggaagaagtcaatatcactaacatcatcaacagctccatctct
agctttaaacggaagatcagctttgccaccattgaaatttctggtgataacgttgactac
agcaacctgagtatgaaaaccagcgacaagttcaagttcgtcttccgagataagatgggc
aggattgtggattatttcacaattcggaaccccagtaatgttgacagatattccaaactg
ctatttcctttgatttttatgctagccaatgtattttactgggcatactacatgtatttt
taa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518995
Entry
107518995         CDS       T06036                                 

Gene name
GABRB1
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit beta-1
  KO
K05181  gamma-aminobutyric acid receptor subunit beta
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04723  Retrograde endocannabinoid signaling
ray04726  Serotonergic synapse
ray04727  GABAergic synapse
ray05032  Morphine addiction
ray05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107518995 (GABRB1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107518995 (GABRB1)
   04726 Serotonergic synapse
    107518995 (GABRB1)
   04723 Retrograde endocannabinoid signaling
    107518995 (GABRB1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107518995 (GABRB1)
   05033 Nicotine addiction
    107518995 (GABRB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107518995 (GABRB1)
Ion channels [BR:ray04040]
 Ligand-gated channels
  GABA-A
   107518995 (GABRB1)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb OAD_gamma
Other DBs
NCBI-GeneID: 107518995
NCBI-ProteinID: XP_016016665
LinkDB
Position
Unknown
AA seq 474 aa
MWTVQNRESLGLLSFPVMIAMVCCAHSANEPSNMSYVKETVDRLLKGYDIRLRPDFGGPP
VDVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPD
TYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIE
SYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVSKKVEFTTGSYPRLSLSFRLK
RNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTISTHLRETLPKI
PYVKAIDIYLMGCFVFVFLALLEYAFVNYIFFGKGPQKKGAGKQNQNANEKNKLEMNKVQ
VDAHGNILLSTLEIRNETSGSEVLTGVSDRNATMYSYDSASIQYRKPMSSREAYGHALDR
HGAHSKGRIRRRASQLKVKIPDLTDVNSIDKWSRMFFPITFSLFNVVYWLYYVH
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgtggacagtacaaaatcgagagagtttggggcttctctctttccctgtgatgattgcc
atggtctgttgtgcacacagcgccaatgaacccagcaacatgtcatacgtgaaagagaca
gtggacagattgctcaaaggatatgacattcgcttgcggccggactttggagggcccccc
gtggacgtcgggatgcgaatagatgtcgccagcatagacatggtctctgaagtgaacatg
gattatacactcaccatgtatttccagcagtcttggaaagacaaaagactttcttattct
ggaatcccactaaacctcacactagacaacagggtagctgaccaattgtgggtaccagac
acctactttctaaatgacaagaaatcatttgtgcatggggttacagtgaaaaatcgaatg
atccggctgcatccagatggaacagttctctatggactacgaattacaaccacagctgca
tgtatgatggatttacgaagatatcctctggatgaacaaaactgcactctggagattgaa
agttatggctataccactgatgacattgagttttattggaatggaggagaaggagcagta
actggagttaataaaattgagctgcctcagttttcaattgttgactacaagatggtgtcc
aagaaggtggagttcacaactgggtcatatccacgactgtcactaagttttcgtctaaag
agaaacattggttacttcattttgcaaacctacatgccttccacactgattacaattctg
tcttgggtgtctttttggatcaactatgatgcatctgcagccagagtcgcactaggaatc
accacggtgctgacaatgacaaccatcagcactcacctcagggagaccctgccaaagatt
ccttacgttaaagcaattgatatatacctgatgggttgctttgtgtttgtgttcctggct
ctgctggaatacgcttttgtaaattatatcttcttcggaaaaggccctcagaaaaaggga
gctggcaaacaaaaccagaacgccaatgagaagaacaaactagagatgaataaagtccag
gtcgacgcccatggtaacattctactcagcaccctggaaatcaggaacgagacgagtggc
tctgaagtgctcacgggcgtgagtgaccgcaacgccaccatgtactcctacgacagcgcc
agcatccagtaccgcaagccgatgagcagccgcgaggcgtacgggcacgcgctggaccgc
catggcgcgcacagcaaggggcgcatccgcaggcgcgcctcgcagctaaaagtcaaaatc
ccggatttgactgatgtgaattccatagacaagtggtcccgaatgtttttccctattacc
ttttctcttttcaacgtcgtttattggctgtactatgtacactaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519003
Entry
107519003         CDS       T06036                                 

Gene name
GABRA4
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit alpha-4 isoform X1
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04723  Retrograde endocannabinoid signaling
ray04727  GABAergic synapse
ray04742  Taste transduction
ray05032  Morphine addiction
ray05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107519003 (GABRA4)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107519003 (GABRA4)
   04723 Retrograde endocannabinoid signaling
    107519003 (GABRA4)
  09157 Sensory system
   04742 Taste transduction
    107519003 (GABRA4)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107519003 (GABRA4)
   05033 Nicotine addiction
    107519003 (GABRA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107519003 (GABRA4)
Ion channels [BR:ray04040]
 Ligand-gated channels
  GABA-A
   107519003 (GABRA4)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb DUF4396
Other DBs
NCBI-GeneID: 107519003
NCBI-ProteinID: XP_016016679
LinkDB
Position
Unknown
AA seq 554 aa
MVSVKKVPAIATSFGVSFALLHVLCLAACLNESPGQNQKEEKLCPENFTRILDSLLDGYD
NRLRPGFGGPVTEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWIDKRLKYDGPIEILRLN
NMMVTKVWTPDTFFRNGKKSVSHNMTAPNKLFRIMRNGTILYTMRLTISAECPMRLVDFP
MDGHACPLKFGSYAYPKSEMIYTWTKGPEKSVEVPKESSSLVQYDLVGQTVSSETIKSIT
GEYIVMTVYFHLRRKMGYFMIQTYIPCIMTVILSQVSFWINKESVPARTVFGITTVLTMT
TLSISARHSLPKVSYATAMDWFIAVCFAFVFSALIEFAAVNYFTNIQMQKAKRKTSKAVQ
EIPAAPMLREKQTEAPLQNTNANLNMRKRTNALVHSQSDVGIRTEVGNHLSRSSMAVQES
SEATSQSYLASSPNPFSHANAAETISAARALPSASSTPSRTGYVPRQASVGSASTRHMFG
SRLERIKTTVNTIGASGKLSAVTPPSSPPPSGSGTSKIDKYARILFPVTFGAFNMVYWVV
YLSKDTMEKSESLM
NT seq 1665 nt   +upstreamnt  +downstreamnt
atggtttctgtcaagaaggtacccgcgatcgcgacgtccttcggggtcagtttcgccctc
ctgcacgtcctgtgcctggcggcttgtttaaacgaatccccaggacagaaccaaaaggag
gagaaattatgcccagaaaattttacccgcatcctggacagtttactcgatggttatgac
aacagactgcgtcctggatttgggggtcctgttacagaagtaaaaactgacatatatgtc
accagctttggacctgtttctgatgttgaaatggaatacacaatggacgtgttcttcaga
cagacatggattgacaaaagattgaaatatgatggtcccattgaaattttgagattgaac
aatatgatggtaacaaaagtatggacccccgatactttcttcaggaatggaaagaaatct
gtctcacataatatgacagctccaaataagctttttagaattatgagaaatggcactatt
ttatacacaatgagactcaccataagtgcagagtgtcctatgagattggtggattttccc
atggatggtcatgcatgtcctttgaaatttgggagttatgcttatccgaagagtgagatg
atatatacctggacaaaaggtcctgagaaatcagtagaagttccaaaggaatcctccagc
ttagttcagtatgacttggttgggcaaaccgtatcaagtgaaactatcaaatccatcacg
ggtgaatacattgttatgacggtttacttccacctcagacggaagatgggttattttatg
attcagacgtacatcccatgcattatgacagtgattctttcgcaagtctcattctggata
aataaggaatcagttccagctaggaccgtatttggaataaccacagtcctcaccatgacc
acgctgagcatcagtgcgcggcattctttgcccaaagtgtcctatgctaccgccatggat
tggttcatagctgtctgctttgcttttgtattttcggcccttattgagtttgctgctgtc
aattattttaccaatattcaaatgcaaaaagccaaaaggaagacatccaaagctgtccag
gaaattccggctgcccccatgctgagagaaaaacaaactgaagcacctctgcagaacaca
aatgcaaatctgaacatgaggaaaagaacaaatgctttggttcactctcagtctgatgtt
ggcatcagaactgaggtaggaaaccatttgagcagatcttctatggctgttcaagaatct
tctgaagccacatcacagtcttacttagcttctagtccaaatccgttcagccatgcaaat
gcagctgaaactatttctgctgcaagagctcttccgtctgcttcttctactcctagtaga
actgggtatgtgccccggcaagcttcagttggatctgcttctacccgccatatgtttgga
tcaagactggagcgaattaagaccacagttaatactataggggcttctggaaagctgtca
gccgttactcctccctcttctccaccgccttctggatctggcacaagtaaaatagacaaa
tatgcccgcattctctttccagtaacatttggggcatttaacatggtctattgggttgtt
tatttatctaaggacactatggagaaatcagaaagcctaatgtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520595
Entry
107520595         CDS       T06036                                 

Gene name
GABRA3
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit alpha-3
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04723  Retrograde endocannabinoid signaling
ray04727  GABAergic synapse
ray04742  Taste transduction
ray05032  Morphine addiction
ray05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107520595 (GABRA3)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107520595 (GABRA3)
   04723 Retrograde endocannabinoid signaling
    107520595 (GABRA3)
  09157 Sensory system
   04742 Taste transduction
    107520595 (GABRA3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107520595 (GABRA3)
   05033 Nicotine addiction
    107520595 (GABRA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107520595 (GABRA3)
Ion channels [BR:ray04040]
 Ligand-gated channels
  GABA-A
   107520595 (GABRA3)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107520595
NCBI-ProteinID: XP_016020054
LinkDB
Position
Unknown
AA seq 472 aa
MIISQRSLFYMTNLGLLFMVNILPGTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDS
TDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQ
TWHDERLKFDGPMKILPLNNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLL
YTMRLTIHAECPMHLEDFPMDVHACPLKFGSYAYTTAEVVYSWTLGKNKSVEVAQDGSRL
NQYDLLGHVVGTEIIRSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLN
RESVPARTVFDHVMLIHPSIHGDFCRFHLLAPGDYAAVNTGVQVSLRPRFQRSEPFGVIS
RKKTPAAPTKKTSTTFNIVGTTYPINLAKDTEFSTISKGAAPSASSTPTLIASPKTTYVQ
DIPTETKTYNSVSKVDKISRIIFPVLFAIFNLVYWATYVNRESAIKGMIRKQ
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgataatttcacaaaggagtctcttctatatgaccaaccttgggcttctcttcatggtt
aatattctccctgggacaaccggccaaggagagtcaagaagacaggaacctggggacttt
gtgaagcaggatattggcggactctctcccaagcatgccccagatatccccgatgacagc
actgacaacatcactatcttcaccagaatcttggatcgccttctggatggctatgacaac
cggctgcgacctgggcttggagatgcagtgaccgaagtgaagactgacatctatgtgaca
agttttggccctgtgtcagacactgacatggagtacaccattgatgtattttttcgacag
acatggcatgatgaaagactgaaatttgatggacccatgaagatccttccactgaacaat
ctcctggctagtaagatctggacccctgacaccttctttcacaatggcaagaaatcggtg
gctcataacatgaccacacctaacaagctgctcagactggtggacaatggaaccctcctc
tacacgatgaggttaacaattcatgcggagtgtcccatgcatttggaagattttcccatg
gatgtgcatgcctgcccactgaagtttggaagctatgcctatacaacagccgaagtggtt
tattcttggactcttgggaagaacaagtctgtggaagtagcacaggatggctctcgcctg
aatcagtatgacctcctgggccatgtcgttgggacagagataatccgctctagtacagga
gaatatgtcgtcatgacaacccacttccatctcaagcgaaaaattggctactttgtgatc
cagacctacctgccatgtattatgactgtcattctgtcacaagtgtctttctggctcaac
agagagtctgtccctgcccgcacggtctttgaccacgttatgttaatccatccctccatc
catggagacttctgtcgctttcaccttttggctcctggggattatgctgctgtgaacacg
ggtgtgcaggtatctctgcgacctcgctttcaacgttcagagccttttggagttatttct
cggaagaaaacaccagcagccccgacgaagaaaaccagcaccacgttcaacatcgtgggg
accacctaccccatcaacctggctaaggacaccgagttctccaccatctccaagggcgcc
gctcccagcgcgtcctccaccccgacgctcatcgcctcgcccaagaccacctacgtgcag
gacatcccgaccgagaccaagacctataatagcgtcagcaaggttgacaaaatatcccgc
atcatctttcctgtgctctttgccattttcaatctggtctattgggccacgtacgtcaac
cgggagtcggcgatcaagggcatgatccgcaaacagtag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520600
Entry
107520600         CDS       T06036                                 

Gene name
GABRQ
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit theta
  KO
K05192  gamma-aminobutyric acid receptor subunit theta
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04723  Retrograde endocannabinoid signaling
ray04727  GABAergic synapse
ray05032  Morphine addiction
ray05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107520600 (GABRQ)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107520600 (GABRQ)
   04723 Retrograde endocannabinoid signaling
    107520600 (GABRQ)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107520600 (GABRQ)
   05033 Nicotine addiction
    107520600 (GABRQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107520600 (GABRQ)
Ion channels [BR:ray04040]
 Ligand-gated channels
  GABA-A
   107520600 (GABRQ)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb UPF0640
Other DBs
NCBI-GeneID: 107520600
NCBI-ProteinID: XP_016020062
LinkDB
Position
Unknown
AA seq 633 aa
MCIRGVLRVTVLLLLIRTWLSEGNNASPIPKPRLAGASTAPKLKNVFDCKNCANESVVHK
ILDRVLSGYDVRLRPNFGGAPLPVGISMYVSSIEQISEATMDYTITMFFYQTWKDPRLAY
HETDQNLTLDYRMLEKLWVPDCYFLNSKDSYVHDMTVENRMFQLHPDGTVRYGIRLTTTA
ACFMNLEKFPMDKHTCKLEVESYGYTVDDIILYWEGHEDAIKGTEDLRIPRFSFLGKTMS
NKQVVFYTGSYERLTLKFLVQRDIFSYLVQVYWPTVLTTAASWVSFWMNYECPVARVTVG
LTSMLILNTINSHLQEKLPQFSCIKAIDVYMVVCFFFVFLSLVEYVYINYVFYGRRGSRR
LYKQRRRARRIMARYRYRGAGPKNDQVTIEHESISSHSGSVRARLASPENLSSLSSISKR
APLASSESFSSLSSISRRCRLATKESLNDPSSSSDQCVPQCDIYDSDYDDGSEADPVNIF
RRAEDRSRAVPFDEEDDPRESSSNWRHLLDRRQKSVQKASSDLENLDDVFNISRRISVQR
DRPNVEESARRDDDGNDSSWEGDSFRAFDEEKDSDFGSDDSSPPSPGQSCGRRLVHKIFH
PRYIPNIDKWSQVLFPLAFVLFNIVYWGKNLLM
NT seq 1902 nt   +upstreamnt  +downstreamnt
atgtgcatccgaggggtgctgcgagtcaccgtgctcctgcttctcatcaggacctggctc
tcggagggtaacaatgccagtcccatcccgaaaccccgcttggcgggcgcctctaccgcg
cccaaactcaagaacgtgtttgactgcaaaaattgcgcgaacgaatccgtggttcacaag
attctggacagggtgctgtcgggatacgatgtccgtctgagaccaaattttggaggtgcc
cctttgcccgtgggaatatcaatgtacgtctccagtattgaacagatctcagaagccact
atggactataccatcacgatgtttttttatcagacttggaaagatccacgtttagcatat
catgagaccgaccagaacctgactctcgactatcgcatgctggagaagttgtgggtcccc
gactgttactttctaaatagcaaagatagttatgtgcatgacatgactgtggaaaatcgc
atgtttcagcttcacccagatgggacggtgcggtatggcatccgactcaccaccacggcg
gcttgttttatgaatctggaaaaattccctatggacaagcatacctgcaagttggaggtg
gagagctatggctacacggtcgacgacatcatattgtactgggaaggccatgaggacgcc
atcaaggggaccgaggacctacgcatccctcggttcagcttcctggggaagacgatgagt
aacaagcaagtggttttctacacaggttcctacgagcgcctgacactgaagttcctggtc
cagagggacattttcagctatctcgtgcaggtctactggcccactgtcctcaccactgct
gcctcttgggtatcattttggatgaactatgaatgccctgtagccagggtgacagtcggt
ctgacttcaatgctcatcctgaataccatcaactcacatctgcaggaaaaactcccccag
ttttcctgcatcaaggccatcgacgtctacatggtcgtatgcttcttcttcgtgttcctg
tccttggtagaatacgtctacatcaactatgtcttctacggccgcagagggtcccggcgc
ctttacaagcaacgcaggcgagcccgaagaatcatggcccgctatcgctaccggggggcg
gggccgaagaatgaccaggtcaccatcgaacacgaaagcatctcttctcactccggatcg
gtgcgggcccgcctggcaagcccagaaaacctcagttctctgagctccatctccaagcgg
gccccgctggcttcctcggaaagctttagctcgctgtcttctatctcgcgccgctgccgc
ctggccaccaaagagagcctgaatgatccgtcctccagctcagaccagtgtgtgccgcag
tgtgacatttacgacagcgattacgatgacggtagcgaagctgatcctgttaacatcttc
agacgtgccgaagaccgtagccgtgctgtgccctttgacgaagaagacgaccctagagag
agctccagcaattggaggcatctcctcgaccgccgccagaagtcggtgcagaaagcgagc
agtgacctcgaaaacctcgacgacgtctttaacatttcgagaagaatcagcgtccagcgc
gaccgccctaacgttgaggagagtgcccgtcgcgatgacgatggcaatgacagcagctgg
gagggcgatagtttcagggcctttgatgaggagaaggatagcgatttcgggtctgatgat
agctcccctccaagccccgggcagtcctgtggcaggaggcttgtgcacaagatctttcac
cctcgctacatccctaatatcgacaagtggtcccaggtcctcttccctctggcctttgtg
ctgttcaacattgtttactgggggaagaacttactcatgtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520603
Entry
107520603         CDS       T06036                                 

Gene name
GABRE
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit epsilon
  KO
K05185  gamma-aminobutyric acid receptor subunit epsilon
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04723  Retrograde endocannabinoid signaling
ray04727  GABAergic synapse
ray05032  Morphine addiction
ray05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107520603 (GABRE)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107520603 (GABRE)
   04723 Retrograde endocannabinoid signaling
    107520603 (GABRE)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107520603 (GABRE)
   05033 Nicotine addiction
    107520603 (GABRE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107520603 (GABRE)
Ion channels [BR:ray04040]
 Ligand-gated channels
  GABA-A
   107520603 (GABRE)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107520603
NCBI-ProteinID: XP_016020066
LinkDB
Position
Unknown
AA seq 498 aa
MLTKLLLLLLGIAITLPPRIEGPHAELEKGPSTGLDDVYGPEPHAPPEKLPAEEIKPTID
TPRGFGKLLAATQILDGMLNNYDHRLRPGIGGKPTVVTVMLSVNTLGPISVPNMEYSIDI
TLCQTWYDERLRYNGSFESFVLNGDMVRQLWIPDTFFRNSKKIHNYGVTRLNHMVRIHKD
GKVLYTDRMIIDARCSLYMLKFPMDSHSCPLSFSSFSYPENEIIYKWDDFKLDINDGVSW
KLLQFDFTGVSNETKTISTVAGDFMVTTLFFNVSRRFGFNIFQSYVPSSVTTIISWISFW
IKSDFAQARTSLGITSILTMTTLSSYSQKNFPRVSYMTALDFYIGVCFTFCICALLEFAL
LSFLIYHYTKSRTSPRVRHPATRACALTPLRARPYAHARARQQQDVVYEIEDSEDDSDEE
EGPSCPAQRSLHPGRIQYPGSRCRLCKYMCMARDCKGGLWQQGRLFIHIYRLDNYSRVVF
PVTFFFFNVVYWLVCLNF
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgctaaccaaacttctcctgctcctcctgggcatagccatcaccctcccgccaaggatt
gaaggacctcatgctgaattagagaagggaccctccaccggtctcgatgatgtctatggc
cccgagccccatgctcccccagagaagctccctgctgaagaaataaagcccaccattgat
actcctcgtggatttggaaagctgcttgcagccactcaaatactggacggtatgctgaac
aactatgaccacagactgcgccctggcattggtgggaagcccactgtggtcactgtcatg
ctctctgtcaacacccttggtcctatctctgtcccgaacatggaatactccattgacatc
accttatgccagacctggtatgacgaacgcctccgttacaatggcagctttgagagtttt
gttctgaatggtgacatggtgcgccagttatggatcccggataccttttttcggaattct
aagaagatccacaattatggggtcaccagactcaaccacatggttcgcatccacaaagat
ggcaaggtgttgtacacagataggatgatcattgatgctagatgttcactctacatgctc
aaatttccaatggattctcactcttgccctctgtctttctctagcttttcttatcctgag
aatgagataatatacaagtgggacgatttcaagcttgacatcaacgatggtgtttcctgg
aagcttttacagtttgactttacaggagtgagcaacgagaccaaaactatctcaactgta
gctggtgatttcatggtcaccacacttttcttcaatgtgagcaggcggtttggctttaat
atctttcaaagctatgtcccttcttctgtgaccacgattatctcctggatttccttttgg
atcaagagtgattttgctcaagctaggacctctttagggatcacctctatactcaccatg
accacactgagttcctattcccagaagaatttcccacgtgtctcctatatgacagccttg
gatttctatattggtgtctgcttcaccttctgcatctgtgctctgctggagtttgctctg
ctcagtttcctgatctaccactacacgaaaagccgcacttctccaagagttcgccatcca
gctacccgtgcctgtgcccttacccctctccgtgcccgcccctatgcccacgcccgtgct
cgccagcagcaggatgttgtgtacgagatcgaggactccgaggatgatagtgatgaagag
gagggcccatcttgccccgctcagcgatccctccatcctggtcgcatccagtaccctggc
agccgctgcaggttgtgcaagtacatgtgcatggcccgcgattgtaagggcggtttgtgg
cagcagggtcgcctcttcatccacatctaccgcttggataactactcgcgagttgttttc
cccgtgaccttcttcttcttcaatgtggtctactggcttgtttgccttaacttctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521903
Entry
107521903         CDS       T06036                                 

Gene name
GABRB2
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit beta-2 isoform X1
  KO
K05181  gamma-aminobutyric acid receptor subunit beta
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04723  Retrograde endocannabinoid signaling
ray04726  Serotonergic synapse
ray04727  GABAergic synapse
ray05032  Morphine addiction
ray05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107521903 (GABRB2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107521903 (GABRB2)
   04726 Serotonergic synapse
    107521903 (GABRB2)
   04723 Retrograde endocannabinoid signaling
    107521903 (GABRB2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107521903 (GABRB2)
   05033 Nicotine addiction
    107521903 (GABRB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107521903 (GABRB2)
Ion channels [BR:ray04040]
 Ligand-gated channels
  GABA-A
   107521903 (GABRB2)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107521903
NCBI-ProteinID: XP_016022555
LinkDB
Position
Unknown
AA seq 474 aa
MWRVRKKGYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPV
AVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDT
YFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIES
YGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKR
NIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIP
YVKAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKKAAEKAASANSEKMRLDVNKM
DPHENILLSTLEIKNEMATSEAVMGLGDPRSTMLAYDASNIQYRKAGLPRHSFGRNALER
HVAQKKSRLRRRASQLKITIPDLTDVNAIDRWSRIFFPVVFSFFNIVYWLYYVN
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgtggagagtccggaaaaagggctactttgggatttggtcattccctttaataatcgcc
gctgtctgtgcgcagagtgtcaatgaccctagtaatatgtcactggttaaagagacggtg
gatagactcctgaaaggctatgacattcgtctgagaccagattttggaggtccccccgtg
gccgtgggaatgaatattgacattgctagcatcgatatggtttctgaagtcaatatggat
tataccttgacaatgtattttcagcaagcttggagagataagaggctatcctacaatgta
atacctttaaacttaactctggacaatagagtagcagatcagctctgggtgcccgatacc
tacttcctaaacgataagaagtcatttgtgcatggagtgaccgtcaagaaccgcatgatt
cgtctgcatccggatgggactgtcctttatggcctcagaatcacaaccacagctgcctgt
atgatggacctacggcggtacccactggatgaacaaaactgcaccttggaaattgaaagc
tatggatacacaactgatgacattgagttttactggcgtggcgatgataacgcagtaaca
ggagtgacaaagattgaacttccacagttctctatcgtagattacaagcttatcaccaag
aaggttgttttttccacaggttcctatcccaggttgtccctcagctttaagctgaagaga
aacatcggttactttatcctgcaaacgtacatgccttccatcctgatcactatcctctct
tgggtctccttctggatcaattatgatgcttctgctgcaagagtggcattaggaattaca
actgtcctgacaatgaccaccatcaacacccacctccgggagacgctccctaaaatcccc
tatgtgaaggccattgacatgtacttgatggggtgctttgtctttgttttcatggccctt
ctggaatatgcattggtcaactacatcttctttgggaggggacctcagcgccaaaagaaa
gcagctgagaaggctgccagtgccaacagcgagaagatgcgccttgatgtcaacaagatg
gacccccacgagaacattttgctgagcactcttgagatcaaaaatgaaatggccacatct
gaggctgtgatgggacttggagaccccaggagcacaatgctggcgtacgacgcctccaac
atccagtaccggaaagccggcttgccccggcatagtttcggccgcaatgctctggaacga
catgtggcacaaaagaagagccgcctgcggagacgtgcctcccaactgaaaatcaccatc
cccgacttgactgatgtgaacgccatagatcggtggtcccgcatattcttccccgtggtt
ttttccttcttcaacatcgtctattggctttactatgtgaactaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521904
Entry
107521904         CDS       T06036                                 

Gene name
GABRA1
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit alpha-1
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04723  Retrograde endocannabinoid signaling
ray04727  GABAergic synapse
ray04742  Taste transduction
ray05032  Morphine addiction
ray05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107521904 (GABRA1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107521904 (GABRA1)
   04723 Retrograde endocannabinoid signaling
    107521904 (GABRA1)
  09157 Sensory system
   04742 Taste transduction
    107521904 (GABRA1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107521904 (GABRA1)
   05033 Nicotine addiction
    107521904 (GABRA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107521904 (GABRA1)
Ion channels [BR:ray04040]
 Ligand-gated channels
  GABA-A
   107521904 (GABRA1)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107521904
NCBI-ProteinID: XP_016022559
LinkDB
Position
Unknown
AA seq 456 aa
MKKSLSLSDYLWAWTLLLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRPG
LGERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASK
IWTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHAC
PLKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVM
TTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISA
RNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDP
LIKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKID
RLSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgaagaaaagcctcagtctctctgactatctttgggcctggaccctccttctgagcaca
ctgactggaagaagctatggacaaccatcattacaagatgaacttaaagacaacaccact
gtcttcaccaggattttggaccgactcctagacggttacgacaatcgcctgagaccagga
ttgggagagcgtgtaactgaagtgaagactgacatcttcgtcaccagtttcggacccgtt
tcagaccatgatatggaatatacaatagatgtatttttccgtcaaagctggaaagatgaa
aggttaaaatttaaaggacccatgacagttctccggttaaataacctaatggcaagtaag
atctggactccagatacctttttccataatggaaagaagtcagtggcacacaacatgacc
atgcccaacaaactcctgaggatcacggaggatggcaccttgttgtacaccatgaggctg
acagtgagagctgaatgtccaatgcatttggaagacttccctatggatgcccatgcctgc
ccactcaaatttggaagctatgcttatacaagagcagaagttgtttatgagtggactagg
gagccagcacgctcagtggtagtagcagaagatgggtcgcgcctcaaccagtatgatctt
cttggacaaacagtagactctggaattgttcagtctagtacaggagaatatgttgtgatg
actactcatttccacctgaaaagaaagattggttattttgttattcaaacatacctgcca
tgtataatgacggttattctgtcccaagtctccttctggctcaacagagagtctgtgcca
gcgaggactgtctttggagtaacaactgtgctcaccatgacaactttgagtatcagtgcc
agaaattctctccctaaggtggcttatgcaactgctatggattggtttattgcagtgtgc
tacgcctttgtgttctcagctctgatcgagtttgccactgtaaactatttcaccaagaga
ggttatgcatgggatggaaaaagtgtggttcccgaaaagccaaagaaagtgaaggatcct
cttattaagaaaaacaacacttacgctccgacagcaaccagctatacccctaatttggcc
aggggtgaccccggcttagccaccattgctaaaagtgcaaccatagaaccaaaagaagtc
aagccagaaacaaaaccaccagaacccaagaaaacctttaacagtgtcagcaaaattgac
cggctctcaagaatagccttcccgctgctatttggaatctttaacttggtctactgggct
acatatttaaacagagagcctcagctaaaagcccccaccccacatcaatag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521905
Entry
107521905         CDS       T06036                                 

Gene name
GABRA6
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit alpha-6
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04723  Retrograde endocannabinoid signaling
ray04727  GABAergic synapse
ray04742  Taste transduction
ray05032  Morphine addiction
ray05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107521905 (GABRA6)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107521905 (GABRA6)
   04723 Retrograde endocannabinoid signaling
    107521905 (GABRA6)
  09157 Sensory system
   04742 Taste transduction
    107521905 (GABRA6)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107521905 (GABRA6)
   05033 Nicotine addiction
    107521905 (GABRA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107521905 (GABRA6)
Ion channels [BR:ray04040]
 Ligand-gated channels
  GABA-A
   107521905 (GABRA6)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb DUF4396
Other DBs
NCBI-GeneID: 107521905
NCBI-ProteinID: XP_016022560
LinkDB
Position
Unknown
AA seq 453 aa
MVSPLPWLYLILWVENALGKLEDEGNFYSENISRILDNLLEGYDNRLRPGFGGAVTEVKT
DIYVTSFGPVSDVEMEYTMDVFFRQTWTDERLKFRGPTEILSLNNLMVSKIWTPDTFFRN
GKRSIAHNMTTPNKLFRIMQNGTILYTMRLTINADCPMRLVNFPMDGHACPLKFGSYAYP
KSEIIYTWKKGPLYSVEVPEESSSLLQYDLIGQTVSSETIKSNTGEYVIMTVYFHLQRKM
GYFMIQIYTPCIMTVILSQVSFWINKESVPARTVFGITTVLTMTTLSISARHSLPKVSYA
TAMDWFIAVCFAFVFSALIEFAAVNYFTNLQTQKAKRKAQIAASSPVTISKTNEPMEAEI
VLRSDSKYHLKKRITSLTLPIVPPPEDNKVLTRAPILPSTPVTPPPLSPGFGGTSKIDQY
SRILFPVAFAGFNLVYWIVYLSKDTMEVNNRVE
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggtgtcacctctgccctggctgtaccttattttatgggtagaaaatgctctagggaaa
cttgaagatgaaggaaacttctactcagagaacatcagtcggatcctggacaacttgctt
gaaggctatgacaatcggctgcggcccggatttggaggtgctgtcactgaagtcaaaaca
gacatttacgtgaccagttttgggcctgtgtcagatgtggagatggaatataccatggat
gttttcttccgccagacctggactgatgaaaggttgaagtttagggggccaactgagatt
ttgagtttaaataacttgatggtcagtaaaatctggacacctgatacttttttcaggaat
ggcaaaagatcaattgctcataatatgacaactcctaataaactcttcagaataatgcag
aatggaaccattctatacacaatgaggcttaccatcaatgctgactgtcctatgagactg
gttaacttcccaatggatggccatgcttgtccactcaagtttgggagttatgcttacccc
aagagtgaaatcatatatacatggaaaaaaggaccactttactcagttgaagtcccagaa
gaatcttcaagtctcctccagtatgatctgattggacaaacagtatccagtgagacaatt
aaatctaacacaggtgaatatgtaataatgacagtttatttccacttgcaaaggaagatg
ggctacttcatgatacagatatatacaccttgcattatgaccgtcattctttcccaggtg
tctttctggattaataaggagtctgtcccggcaagaactgtctttgggatcaccactgtt
ttaaccatgaccactttaagcatcagtgcccgacactccttgccaaaagtgtcatatgca
acagccatggattggttcatagctgtttgctttgctttcgtcttctctgctcttattgag
tttgcagctgtcaactactttaccaatcttcagacacagaaggccaaaagaaaggcacag
attgcagcctcatccccagtgacaatatcaaaaacgaatgaacccatggaagctgagatt
gttttgcgctctgattccaaatatcatctgaagaaaagaatcacctctctgaccttgcca
atagtcccaccccctgaggacaacaaagtcctcacgagagctcctatcttaccgtcgaca
cctgtcacccctccaccactctctccaggctttggaggcaccagtaaaatagaccagtat
tctcggattctcttcccagttgcatttgcaggattcaaccttgtatactggatagtttat
ctttccaaagatacaatggaagtgaacaacagggtggaatag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521929
Entry
107521929         CDS       T06036                                 

Gene name
GABRG2
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit gamma-2 isoform X1
  KO
K05186  gamma-aminobutyric acid receptor subunit gamma
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04723  Retrograde endocannabinoid signaling
ray04727  GABAergic synapse
ray05032  Morphine addiction
ray05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107521929 (GABRG2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107521929 (GABRG2)
   04723 Retrograde endocannabinoid signaling
    107521929 (GABRG2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107521929 (GABRG2)
   05033 Nicotine addiction
    107521929 (GABRG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107521929 (GABRG2)
Ion channels [BR:ray04040]
 Ligand-gated channels
  GABA-A
   107521929 (GABRG2)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107521929
NCBI-ProteinID: XP_016022595
LinkDB
Position
Unknown
AA seq 475 aa
MSSPNIWSTECSVYSTPVFSQKMTVWILLLVSLYPGLTSQKSDDDYEDYASNKTWVLTPK
VPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQT
WYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLY
TLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQF
SFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDA
VPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFV
SNRKPSKDKDKKKKNPLLRMFSFKAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGK
DCASFFCCFEDCRTGAWRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYL
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgagttcaccaaatatatggagcacagaatgctcagtctactcgactcctgtgttttca
cagaaaatgacggtgtggatcctgctcctggtatcgctctacccgggactcactagccaa
aaatctgatgacgactatgaagattatgcttctaacaaaacatgggtcttgacaccaaaa
gttcctgaaggagatgttactgttatcttaaacaacctcctggaaggctacgacaataaa
ctacgacctgatataggagtgaaaccaacattaatccacacagacatgtatgtgaatagc
attggtccagtgaatgctatcaatatggaatatacgattgatatattttttgcccaaaca
tggtatgacagacgtttgaaatttaacagcaccattaaagttctccgattgaatagcaac
atggtggggaaaatatggattccagacactttcttcagaaattcaaaaaaggctgatgca
cactggataaccacccccaatagaatgctgagaatttggaatgacggtcgagtgctctac
accttaaggttgactattgatgctgagtgccaattacagttgcacaatttcccaatggat
gaacactcctgccccttggagttctccagttatggatatccacgtgaagaaattgtctat
cagtggaagcgtagttctgttgaagttggtgacacaagatcttggaggctttatcagttt
tcatttgttggactgagaaataccactgaagtcgtgaagacaacttctggagattatgtg
gttatgtctgtctactttgacctgagcagaagaatgggatacttcaccatccagacctac
atcccctgcacactcattgttgttctatcctgggtgtctttttggatcaataaggatgct
gttccagccagaacttctttaggtattaccaccgtcctgacaatgactaccctcagcacc
attgcccggaagtcactccccaaggtctcctatgtcacagcaatggatctctttgtatct
gtctgcttcatatttgtcttctctgctttggtggaatatggcaccctacattattttgtc
agcaaccggaaaccaagcaaggacaaagacaaaaagaagaaaaaccctcttcttcggatg
ttttccttcaaggcccctaccattgatattcgcccaagatcagcaaccattcaaatgaac
aatgccacgcaccttcaagagagagacgaagaatatgggtatgagtgtctggatggcaag
gactgtgccagctttttctgctgttttgaagactgccgaacaggagcctggagacatggg
aggatacatatccgtattgccaaaatggactcatatgcccggatcttcttccccactgca
ttttgcttgttcaatctggtctattgggtctcctacctttacctgtga

DBGET integrated database retrieval system